KEGG   Sinorhizobium fredii USDA 257: USDA257_c55950Help
Entry
USDA257_c55950    CDS       T02188                                 

Definition
uroporphyrinogen-III synthase protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    USDA257_c55950
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     USDA257_c55950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5808951..5809661
Genome map
AA seq 236 aa AA seqDB search
MRVLVTRPRPAAERTALKLAAMGHQPVVLPLMQAQHFAGAVRAGFERRHDAIAVTSAEAV
HALAGLGPALDAHLATPFFAVGSATARAAAELGFADIRVGAGTGEALAETVAGLLGPETG
SLLYFAGLPRADGFEHALRERSIDHVTVECYRMSPVGHAPGTLPALVQSGPFDAVLLYSR
ETARRLVALLRESGLDCADVSARYLCLSASVKEVLPAGVAADVAAAPDEKSLLSLL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtcacccgtccgcgtccggcagccgaaagaacagcgctgaagcttgca
gcgatgggacaccagccggtcgtcctgccactgatgcaggcgcaacattttgccggtgcg
gtgcgcgccgggttcgagcgccgccatgacgcgattgccgtgaccagtgcggaagccgtc
cacgctctggccgggctaggtcccgcacttgacgcgcatctggcgacaccgtttttcgcc
gtcggctcggcgacggcgcgcgccgccgccgagctcggcttcgccgacatccgggtcggg
gcaggaacgggagaagcgctcgccgagactgttgccggcttactcggcccggagacggga
tcgcttctttatttcgccggcttgccgcgcgccgatggtttcgagcatgcgctgcgtgag
cggtcgatcgaccatgtgaccgtcgaatgctaccggatgagccccgtcggccacgcgccg
ggaacactgccggctctcgtccagtccggcccatttgacgcggtgctgctctactcgcgc
gaaacggctcggcgccttgtcgcgctcctgcgcgagagcggccttgattgcgccgacgtt
tccgcccgttacctttgcctcagcgcgtctgtcaaagaggtgctaccggccggcgttgca
gcggatgttgcagcagcaccggacgagaaaagcctgctgagcctcctctga

DBGET integrated database retrieval system