KEGG   Sinorhizobium fredii USDA 257: USDA257_c57440Help
Entry
USDA257_c57440    CDS       T02188                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sfd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5965532..5966212)
Genome map
AA seq 226 aa AA seqDB search
MTKKIACRFRNELMRLKDFLPFFLSLAMTIALSAPSRAESLKLVGFGDSLMAGYQLPPED
AFPARLEKALKAKGLDITIANAGVSGDTTSGGLARIDWSVPDGTKGVILELGANDALRGI
PPEETRKNLEAMLARFEERGIAVLLVGMMAPPNMGADYAARFNSIYSDLAREHNLAFYPF
FLDGVVTKAGLQLEDGMHPNGDGIAVMVERFLSTAEQFVRSLQKGE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaagattgcttgccgatttaggaacgaacttatgcgattgaaagattttctc
ccgtttttcttgagcctggcaatgacaatcgcgttatcggcgccaagccgtgccgaaagc
ctgaagctcgtcggcttcggcgacagcctgatggccggctaccagcttccgccggaggat
gcctttcccgcccggctcgagaaggccctgaaagccaaggggctcgacatcacgatcgcc
aatgcgggcgtgtcgggcgacacgacgtcgggcggtctcgcccgtatagactggtcggtg
ccggacggaacgaagggcgtaatcctcgaactcggcgccaatgacgcgctgcgcggcatt
ccgcccgaggaaacccgcaagaacctggaagccatgctcgcgcggttcgaggagcgtggt
atcgccgtgctgctcgtcggcatgatggcgccgccaaacatgggtgccgactacgcggcg
cgcttcaattcgatttattccgacctggcgagggaacacaaccttgccttctaccctttc
tttctcgacggcgtcgtgaccaaggcggggctgcaacttgaagacggcatgcatccgaac
ggcgacggcatcgccgtgatggtagagcgttttctttcgacggccgagcaattcgtcagg
tcgcttcagaaaggagaatga

DBGET integrated database retrieval system