KEGG   Sinorhizobium fredii USDA 257: USDA257_c58900Help
Entry
USDA257_c58900    CDS       T02188                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00260  Glycine, serine and threonine metabolism
sfd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01130  Biosynthesis of antibiotics
sfd01230  Biosynthesis of amino acids
Module
sfd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    USDA257_c58900 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    USDA257_c58900 (trpB)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     USDA257_c58900 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFL54401
UniProt: I3XEU5
Position
6134465..6135685
Genome map
AA seq 406 aa AA seqDB search
MNQPLKPNSFRAGPDEDGRFGIFGGRFVAETLMPLIIDLQDEWSKAKNDPAFKAELENLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLARRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGQEAKEQILAAEGRLPDLVI
AAVGGGSNAIGIFHPFLDDEGVRIVGVEAGGKGLEGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPTMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagccgctaaaaccgaactccttcagggccggaccggacgaggacggccgtttc
ggtattttcggcggccgtttcgtcgccgagactctgatgccgctgatcatcgatcttcag
gacgaatggagcaaggccaagaacgacccggccttcaaggcggagctcgaaaacctcggc
acccactatatcggccggccgagcccgctatacttcgccgaacgcctgaccgccgagctc
ggcggcgcgaagatctatttcaagcgtgaggagctgaaccacaccggctcgcacaagatc
aacaattgcatcggtcagatcctgctggccaggcgcatgggcaagacccgcatcatcgcc
gagaccggcgccggccagcacggcgtcgcctctgcgaccgttgccgcgcgcttcgggctt
ccctgcgtggtctatatgggcgccaccgacgtcgagcgccaggcgccgaacgtcttccgc
atgaagctgctcggcgccgaggtgaagcctgtgaccgccggtcacggcacgctgaaggac
gccatgaacgaggcgctgcgcgactgggtcacgaacgtcgacagcacctattacctgatc
ggcacggccgccggcccgcatccctatccggagatggtgcgcgacttccaggcggtcatc
ggccaggaggccaaggaacagattctcgcggccgagggccgcctgcccgaccttgtcatc
gcggcggtcggcggcggctcgaacgccatcggcatcttccacccgttcctcgatgacgag
ggggtgaggatcgtcggcgtcgaagcgggcggaaagggacttgagggcgacgagcactgt
gcctcgatcactgccggctcgccgggcgtcctgcatggcaaccgtacttacctgcttcag
gacggcgacggccagatcaaggaaggccactccatctcggccggcctcgattatccgggt
atcggtccggaacatgcctggctcaacgatatcggccgggtcgaatatgtgccgatcatg
gaccatgaggcgctcgaagctttccagacgctgacgcggctcgaaggcatcatcccggcg
ctcgaaccgtcgcatgcgctggccgaggttatcaagcgggcgccgacaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtcggcaaa
attctgggaatggggcagtaa

DBGET integrated database retrieval system