KEGG   Sinorhizobium fredii USDA 257: USDA257_c58900Help
Entry
USDA257_c58900    CDS       T02188                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    USDA257_c58900 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    USDA257_c58900 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    USDA257_c58900 (trpB)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     USDA257_c58900 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6134465..6135685
Genome map
AA seq 406 aa AA seqDB search
MNQPLKPNSFRAGPDEDGRFGIFGGRFVAETLMPLIIDLQDEWSKAKNDPAFKAELENLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLARRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGQEAKEQILAAEGRLPDLVI
AAVGGGSNAIGIFHPFLDDEGVRIVGVEAGGKGLEGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPTMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagccgctaaaaccgaactccttcagggccggaccggacgaggacggccgtttc
ggtattttcggcggccgtttcgtcgccgagactctgatgccgctgatcatcgatcttcag
gacgaatggagcaaggccaagaacgacccggccttcaaggcggagctcgaaaacctcggc
acccactatatcggccggccgagcccgctatacttcgccgaacgcctgaccgccgagctc
ggcggcgcgaagatctatttcaagcgtgaggagctgaaccacaccggctcgcacaagatc
aacaattgcatcggtcagatcctgctggccaggcgcatgggcaagacccgcatcatcgcc
gagaccggcgccggccagcacggcgtcgcctctgcgaccgttgccgcgcgcttcgggctt
ccctgcgtggtctatatgggcgccaccgacgtcgagcgccaggcgccgaacgtcttccgc
atgaagctgctcggcgccgaggtgaagcctgtgaccgccggtcacggcacgctgaaggac
gccatgaacgaggcgctgcgcgactgggtcacgaacgtcgacagcacctattacctgatc
ggcacggccgccggcccgcatccctatccggagatggtgcgcgacttccaggcggtcatc
ggccaggaggccaaggaacagattctcgcggccgagggccgcctgcccgaccttgtcatc
gcggcggtcggcggcggctcgaacgccatcggcatcttccacccgttcctcgatgacgag
ggggtgaggatcgtcggcgtcgaagcgggcggaaagggacttgagggcgacgagcactgt
gcctcgatcactgccggctcgccgggcgtcctgcatggcaaccgtacttacctgcttcag
gacggcgacggccagatcaaggaaggccactccatctcggccggcctcgattatccgggt
atcggtccggaacatgcctggctcaacgatatcggccgggtcgaatatgtgccgatcatg
gaccatgaggcgctcgaagctttccagacgctgacgcggctcgaaggcatcatcccggcg
ctcgaaccgtcgcatgcgctggccgaggttatcaagcgggcgccgacaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtcggcaaa
attctgggaatggggcagtaa

DBGET integrated database retrieval system