KEGG   Sinorhizobium fredii USDA 257: USDA257_c58910Help
Entry
USDA257_c58910    CDS       T02188                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    USDA257_c58910 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    USDA257_c58910 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    USDA257_c58910 (trpA)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     USDA257_c58910 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6135691..6136530
Genome map
AA seq 279 aa AA seqDB search
MTARIEQRFADVAAEGRPVLVTYFMGGDPDFATSLAIMQALPKAGADVIELGVPFSDPMA
DGPAIQLAGQRALKAGQTLARTLELARRFRAEDQRTPVVLMGYYNPIYIYGVERFLNDAV
EAGVDGLIVVDLPPEMDDELCIPALKKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSLIAGAVARIKSHTKLPVCVGFGVKTADHARVIGASADGVVVGTAIVNQ
IASSLTEEGHVTEATVPGVEALVRGLSAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatcgagcagaggttcgccgacgtcgcggcggaaggccgcccggtcctc
gtcacctatttcatgggcggcgatcccgacttcgcaacgtccctggcgatcatgcaggca
ctgccgaaggcgggcgccgacgtgatcgaactgggcgtgccgttttccgatccgatggcc
gacggtccggcgatccagcttgccggccagcgcgccctgaaagccgggcagacgctcgcc
aggacgctcgaactcgcccgccgcttccgggccgaagatcagcgcaccccggtcgtgctg
atgggctattacaatccgatctatatctacggcgtcgaacggttcttgaacgatgcggtc
gaggcgggtgtcgacggactgatcgtcgtcgatctgcctccggaaatggacgacgaactg
tgcatcccggccctgaagaagggcatcagcttcatccgtctggcgacgccgacgacggat
gaccgccgtctgcccaaggttctcgaaaacacctccggtttcgtctattacgtctcgatg
accggcatcaccggttccgccttgcccgatccgtcgctgattgccggtgcggtggcacgg
atcaagtcacacacgaagctgcccgtctgtgtcggcttcggcgtcaagaccgccgaccat
gcgcgggtgatcggcgcctcggccgatggtgtcgtggttggcacggcgatcgtcaaccag
atcgcctcgagcctgaccgaagaaggtcacgtcaccgaggcgacggtgcccggcgtcgag
gcgcttgtgcgggggctttcggccggggtgcgggccgcacgccttgcggcagccgaataa

DBGET integrated database retrieval system