KEGG   Sinorhizobium fredii USDA 257: USDA257_c59250Help
Entry
USDA257_c59250    CDS       T02188                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00620  Pyruvate metabolism
sfd00630  Glyoxylate and dicarboxylate metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01200  Carbon metabolism
Module
sfd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    USDA257_c59250 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    USDA257_c59250 (glcB)
Enzymes [BR:sfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     USDA257_c59250 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFL54435
UniProt: I3XEX9
Position
6173587..6175758
Genome map
AA seq 723 aa AA seqDB search
MDRVENNDLKIDAGLHRFLVDEAMPGTGVDPDHFFSALAELVHDLAPKNRTLLAKRDELQ
AKLDAWYREHGAPVDLDAYQAFLREIGYLLPEGPDFSVSTANVDAEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPDADGAERGRSYNPARGAKVIAWARDFLDASVPL
ATGRWSEVAALAIDGPALSLSLTNGATMSLRNPAQFAGYSGSAATPSEIVLTQNNLHIVI
VLDATTPIGKADQAGISDVILESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLEE
EVAKGGRTFTRKLNADRVFTRSDGSALTLPGRSLMLVRNVGHLMTNPAILDRDGREVPEG
IMDAMVTALIALHDIGPSGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NAIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWIGAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRINVAEVQADFKSRPRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVLDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAAVVDQQNAGDPHYAPMAGHFDESIAFRAALELVLNGREQPNGYTEPVLHRRRLELKAK
LTA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaacaatgatctgaagatcgatgcgggccttcaccgcttcctggtc
gacgaggcgatgccgggcaccggcgtcgatcccgaccatttcttttccgccctcgcggaa
ctcgtccatgatctcgcgccgaagaaccgaacgcttctcgccaagcgcgacgaactccag
gcaaagctcgatgcctggtaccgcgaacatggtgctccggtcgacctcgatgcctatcag
gctttcctgagagagatcggctatctcctgccggaggggccggatttctcggtgtcgacc
gccaatgtcgatgccgaaatcgccaccattgcggggccgcaactcgtcgttccggtgatg
aatgcccgctatgcgctgaacgccgccaatgcgcgctggggttcgctctatgacgcgctc
tacgggaccgacgctattcccgatgcggacggggccgagcgcggcagaagctataatccg
gcgcgcggtgccaaggtcattgcctgggcacgggattttctcgacgcgagcgttccgctt
gccacgggccgctggagcgaggtcgctgcgcttgcgatcgacgggcctgctctttcgctg
agcttgacgaacggcgccacgatgtcgcttcggaatccggctcagttcgccggctattcc
gggtccgcggcgacgccttccgagatcgtcctcacccagaacaatcttcacatcgtcatc
gtcctcgatgcaacgacgccgatcggcaaggctgaccaggccggcatttccgacgtcatc
ctcgaatcggcgatcacgacgatcatggactgcgaggactccattgccgcggtcgatgcc
gaggacaaggtcgttgtctatcgaaactggctcgggctgatgaaaggcgacctcgaggaa
gaggtcgccaagggcggcaggacgttcacgcgcaagctcaatgctgaccgcgttttcacc
aggtccgatggttcggcgctgacgttgcccggtcgttcgctgatgctggtgcgcaatgtc
gggcatttgatgaccaatccggcgatcctcgaccgtgacggccgcgaggtgcccgaaggc
atcatggacgccatggtgacggcgctgatcgctctgcacgatatcggcccgagcggaagg
cgggcaaactcgcgcagcggctcgatgtatgtagtcaagccgaagatgcacggcccggag
gaagtggccttcgcctgcgagattttcgctcgcgtcgaggcggcgctcgggcttccggcc
aatgccatcaagatgggcatcatggacgaggaacggcgcaccaccgtcaatctcaaggaa
tgcatccgcgccgcccgcgagcgggtcgtcttcatcaataccggcttcctcgaccgtacc
ggcgacgagatccatacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcggcctggatcggtgcctacgaaaattggaatgtcgatatcggcctcgagtgcggc
ctttccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggccgcc
atgctggagcagaagatcgcccatccgaaggccggcgccaatactgcctgggttccctcg
ccaacggcggcgacgttgcacgccacgcattatcaccggatcaacgttgccgaggtacag
gcggacttcaagagccggccgcgtgccaagctcgccgatattctctcggtaccggtggcg
gcgcggccgaactggacagaagaggagatccagcgcgaactcgacaacaacgcccagggc
attctcggctatgtcgtgcgctgggtcgaccagggcgtcggctgctcgaaggtgctcgac
atcaacaatgtcggtctgatggaagaccgcgcgacgctgcgcatctcggcgcagcacatg
gccaactggctgcaccatggcatcgtcagcgaggcgcagatcgtcgagacgatgaagcgg
atggcggccgtcgtcgaccagcagaatgcaggcgatccgcactatgcgcccatggccggc
catttcgacgaatcgatcgccttccgggcagcgctcgaactggtgctcaatggccgcgag
cagccgaacggctataccgaaccagtgctgcaccgccgccgcctggagctcaaggcgaaa
ctgaccgcttga

DBGET integrated database retrieval system