KEGG   Sinorhizobium fredii USDA 257: USDA257_c59250Help
Entry
USDA257_c59250    CDS       T02188                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sfd01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sfd00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sfd00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6173587..6175758
Genome map
AA seq 723 aa AA seqDB search
MDRVENNDLKIDAGLHRFLVDEAMPGTGVDPDHFFSALAELVHDLAPKNRTLLAKRDELQ
AKLDAWYREHGAPVDLDAYQAFLREIGYLLPEGPDFSVSTANVDAEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPDADGAERGRSYNPARGAKVIAWARDFLDASVPL
ATGRWSEVAALAIDGPALSLSLTNGATMSLRNPAQFAGYSGSAATPSEIVLTQNNLHIVI
VLDATTPIGKADQAGISDVILESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLEE
EVAKGGRTFTRKLNADRVFTRSDGSALTLPGRSLMLVRNVGHLMTNPAILDRDGREVPEG
IMDAMVTALIALHDIGPSGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NAIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWIGAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRINVAEVQADFKSRPRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVLDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAAVVDQQNAGDPHYAPMAGHFDESIAFRAALELVLNGREQPNGYTEPVLHRRRLELKAK
LTA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaacaatgatctgaagatcgatgcgggccttcaccgcttcctggtc
gacgaggcgatgccgggcaccggcgtcgatcccgaccatttcttttccgccctcgcggaa
ctcgtccatgatctcgcgccgaagaaccgaacgcttctcgccaagcgcgacgaactccag
gcaaagctcgatgcctggtaccgcgaacatggtgctccggtcgacctcgatgcctatcag
gctttcctgagagagatcggctatctcctgccggaggggccggatttctcggtgtcgacc
gccaatgtcgatgccgaaatcgccaccattgcggggccgcaactcgtcgttccggtgatg
aatgcccgctatgcgctgaacgccgccaatgcgcgctggggttcgctctatgacgcgctc
tacgggaccgacgctattcccgatgcggacggggccgagcgcggcagaagctataatccg
gcgcgcggtgccaaggtcattgcctgggcacgggattttctcgacgcgagcgttccgctt
gccacgggccgctggagcgaggtcgctgcgcttgcgatcgacgggcctgctctttcgctg
agcttgacgaacggcgccacgatgtcgcttcggaatccggctcagttcgccggctattcc
gggtccgcggcgacgccttccgagatcgtcctcacccagaacaatcttcacatcgtcatc
gtcctcgatgcaacgacgccgatcggcaaggctgaccaggccggcatttccgacgtcatc
ctcgaatcggcgatcacgacgatcatggactgcgaggactccattgccgcggtcgatgcc
gaggacaaggtcgttgtctatcgaaactggctcgggctgatgaaaggcgacctcgaggaa
gaggtcgccaagggcggcaggacgttcacgcgcaagctcaatgctgaccgcgttttcacc
aggtccgatggttcggcgctgacgttgcccggtcgttcgctgatgctggtgcgcaatgtc
gggcatttgatgaccaatccggcgatcctcgaccgtgacggccgcgaggtgcccgaaggc
atcatggacgccatggtgacggcgctgatcgctctgcacgatatcggcccgagcggaagg
cgggcaaactcgcgcagcggctcgatgtatgtagtcaagccgaagatgcacggcccggag
gaagtggccttcgcctgcgagattttcgctcgcgtcgaggcggcgctcgggcttccggcc
aatgccatcaagatgggcatcatggacgaggaacggcgcaccaccgtcaatctcaaggaa
tgcatccgcgccgcccgcgagcgggtcgtcttcatcaataccggcttcctcgaccgtacc
ggcgacgagatccatacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcggcctggatcggtgcctacgaaaattggaatgtcgatatcggcctcgagtgcggc
ctttccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggccgcc
atgctggagcagaagatcgcccatccgaaggccggcgccaatactgcctgggttccctcg
ccaacggcggcgacgttgcacgccacgcattatcaccggatcaacgttgccgaggtacag
gcggacttcaagagccggccgcgtgccaagctcgccgatattctctcggtaccggtggcg
gcgcggccgaactggacagaagaggagatccagcgcgaactcgacaacaacgcccagggc
attctcggctatgtcgtgcgctgggtcgaccagggcgtcggctgctcgaaggtgctcgac
atcaacaatgtcggtctgatggaagaccgcgcgacgctgcgcatctcggcgcagcacatg
gccaactggctgcaccatggcatcgtcagcgaggcgcagatcgtcgagacgatgaagcgg
atggcggccgtcgtcgaccagcagaatgcaggcgatccgcactatgcgcccatggccggc
catttcgacgaatcgatcgccttccgggcagcgctcgaactggtgctcaatggccgcgag
cagccgaacggctataccgaaccagtgctgcaccgccgccgcctggagctcaaggcgaaa
ctgaccgcttga

DBGET integrated database retrieval system