KEGG   Sinorhizobium fredii USDA 257: USDA257_c59570Help
Entry
USDA257_c59570    CDS       T02188                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    USDA257_c59570 (deoA)
Enzymes [BR:sfd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     USDA257_c59570 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6213780..6215096
Genome map
AA seq 438 aa AA seqDB search
MPMLPQEVIRKKRDGAQLERAEIGDFITGVADGSISEGQVAAFAMAVWFSGMNRHECVAL
TLAMRDSGETLDWSALGRPVVDKHSTGGVGDNVSLMLAPIVAACGPIVPMISGRGLGHTG
GTLDKLESIPGYDIQPSPALFHRVVDEVGCAIIGQTANLAPADKRLYAIRDVTATVDSVP
LITASILSKKLAAGLQSLVLDVKLGNGSLLTDPGETEILAQSLVDVANGAGVRTSALITD
MNEPLADASGNALEIENCLAFLRGEKAGTRLDRVVMAFAAEMLVAAGVATDEMEAEALAR
NALASGAAMERFGRMVHLLGGPADFVDRSDTYLKKAPVAVAVPAHRDGYLAACETRELGM
AVIALGGGRTHPDESIDHRVGLSHLRPLGTKLDKGEPIAFVHAADRQQAEAVRDRVAKLY
VIADERPASRPVVLSKIT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgcttccccaggaggtgatccggaagaagagggatggcgcccagctggaacga
gcggagataggcgacttcatcacgggcgtcgcggacggctcgatctccgagggtcaggtc
gccgccttcgccatggccgtctggttttccggcatgaaccgccacgaatgcgtggcgctg
acgctggcgatgcgcgattccggcgaaacactcgattggagcgcgctcgggcggccggtc
gtcgacaagcattcgaccggtggggttggcgacaacgtctcattaatgctggcgccgatc
gttgccgcctgcggccccattgttccgatgatctccggccgcggcctcggccacaccggc
ggcacgctcgacaagctcgaatccattccgggctatgatatccagccatctccggcgctg
tttcatagggtggtcgacgaagtcggctgcgccatcatcggccagaccgccaatctggcg
ccggccgacaagcggctctatgcgatccgcgatgtgacggcgacggtcgattcggtgccg
ttgatcaccgcctcgatcctttcgaagaagctcgccgccggcctccagtcgctggtgctg
gacgtgaagctcggcaacggttccttactgactgatcccggcgaaaccgaaattttggcg
caatcgctcgtcgatgtcgccaatggggcgggtgtgcggacttcggcgctgatcaccgac
atgaacgagccgctagcggatgcctccggcaatgcgctcgagatcgagaactgtctcgct
tttctgcgcggcgagaaggcggggacgcggcttgatcgtgtggtgatggccttcgcggcc
gaaatgctcgtcgccgcgggcgtggcgacggacgagatggaggccgaggcgctggcgcgg
aacgctcttgcaagcggggctgcgatggaacgcttcggccgcatggtgcatctgcttggt
ggcccggcggacttcgtcgaccggtcggatacctatctcaagaaggcgccggtcgcagtc
gccgtgcccgctcatcgcgatggctatctggccgcctgcgagacccgcgaactgggcatg
gcggtcattgcgctcggcggcgggcgtacccacccggacgagagtatcgaccaccgggtc
ggcctttcccatttgaggccactcggaacgaagctcgataagggcgaaccgatcgccttc
gttcatgcggccgaccggcaacaggccgaagcagtgagagacagggttgcgaagctctat
gtgatcgccgacgaacggccagcatcgcgccccgtggtcctgtcgaaaattacctga

DBGET integrated database retrieval system