KEGG   Sinorhizobium fredii USDA 257: USDA257_c59860Help
Entry
USDA257_c59860    CDS       T02188                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    USDA257_c59860 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c59860 (glk)
   00052 Galactose metabolism
    USDA257_c59860 (glk)
   00500 Starch and sucrose metabolism
    USDA257_c59860 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    USDA257_c59860 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    USDA257_c59860 (glk)
   00524 Butirosin and neomycin biosynthesis
    USDA257_c59860 (glk)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     USDA257_c59860 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6243137..6244156
Genome map
AA seq 339 aa AA seqDB search
MPSASEHSFSFPILIGDIGGTNARFALLVDAASELLQLPPVKTGDFATIEEALQKSILDQ
IAEKPRSAILAVAGPIKSDEIPLTNAGWVIRPKDMLARLGLEDVLVINDFEAQALAIAAP
ADQDVVQIGGGSVRPRSSRVVLGPGTGLGVAGLVFAQDTWIPVPGEGGHVDIGPRSERDF
RIWPFLDPIECRMAGEQILCGRGIMNLYRAVCAADGVEPSLKDQAEVTTRALSGQDPAAV
ETVSLFCTYLGRVAGDMALIFMARGGVFLAGGISQKILSALMKPEFRAAFEDKAPHSALM
RSIPTFAVVHPMAALSGLAAFARAPRDFGVAMEGRRWRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgcgagtgaacacagtttctcctttccgatattgatcggcgatatcggtggc
accaacgcccgtttcgcattgctcgtcgatgcagcttccgagctcctgcaactgccgccc
gtcaagacgggtgacttcgcgactatcgaagaagcgctgcagaagagcattctcgaccag
atcgccgaaaaaccgcgctcggcgatcctcgccgtggcagggccgatcaagagcgacgag
attccgctaaccaacgccggctgggttatccggccgaaggacatgctggcgcggctcgga
ctggaagacgtgctggtcatcaacgacttcgaggcgcaggcgctcgccattgccgcgccg
gccgaccaggacgtcgtgcagatcggcggtggcagcgtgcggccgcggagttcccgcgtg
gtgctcggccccggcaccgggctcggcgtcgccggcctcgtcttcgcgcaggacacctgg
attcccgttccgggcgaaggcggccatgtcgacatcggaccgcgcagcgaacgcgatttc
cgcatatggccgttcctcgatccaatcgagtgccgcatggcgggagagcagatcctttgc
ggccgcggcatcatgaatctctaccgcgccgtctgcgcggccgatggcgtcgagccgtcg
ctgaaggatcaggcggaggtgacgaccagggcgctttccgggcaagacccggcggcggtc
gagacagtgtcgctgttctgcacctatctgggccgcgttgccggcgacatggcgctgatc
ttcatggcgcgcggcggagtcttcctggccggcggtatttcgcagaagatattgtcggcc
ctgatgaagccggaattccgcgccgccttcgaggacaaggcgccgcactcggcgctgatg
cgatcgattcccacttttgcggtggttcatccgatggcggcgctttccgggcttgccgcc
ttcgcacgcgcgccgcgagatttcggtgttgcaatggagggacggcgctggagaagctga

DBGET integrated database retrieval system