KEGG   Sinorhizobium fredii USDA 257: USDA257_c60580Help
Entry
USDA257_c60580    CDS       T02188                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    USDA257_c60580 (recR)
DNA repair and recombination proteins [BR:sfd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      USDA257_c60580 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6318056..6318661
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQSVIIVVEDVADLWALERAAALNAAYHVLGGTLSPLDGI
GPDDLNIKGLVDRVAKGGVRELVIAVNATVEGQTTAHYITDQLEGMEVKITRLAHGVPVG
GELDYLDEGTLTAALRARTTI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtcccgaaatcgaaaagctcatccagctcctggcgaaggtg
ccgggccttgggccccgttccgcgcggcgcgcggcgctgcatctcgtcaagaagaaggag
cagttgctcgggccgcttgccgaggcgatgggcgaggcgcaccgcaaggtcaagatctgc
tcctgctgcggcaatgtcgatacgatcgatccctgcaccgtctgcaccgacgagcggcgc
gatcagtcggtgatcatcgtcgtcgaggacgtcgccgatctgtgggccctggagcgcgcc
gcggcgctgaatgccgcctaccacgtgctcggcggcacgctgtcgccgctcgacggcatc
ggcccggacgacctgaacatcaagggcctggtggatcgcgtcgccaagggcggggtgcgc
gagctggtcatcgcggtcaacgcgaccgtcgaaggccagacgaccgcccactacatcacc
gaccagctcgaaggcatggaagtgaagatcacccgcctcgcccatggcgttccggtcggc
ggcgagctcgactatctcgacgaaggcacgctgacggccgcgcttagggcgcgtacgaca
atctga

DBGET integrated database retrieval system