KEGG   Sinorhizobium fredii USDA 257: USDA257_c62210Help
Entry
USDA257_c62210    CDS       T02188                                 

Gene name
fadB2
Definition
enoyl-CoA hydratase FadB (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    USDA257_c62210 (fadB2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    USDA257_c62210 (fadB2)
   00650 Butanoate metabolism
    USDA257_c62210 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    USDA257_c62210 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    USDA257_c62210 (fadB2)
   00310 Lysine degradation
    USDA257_c62210 (fadB2)
   00360 Phenylalanine metabolism
    USDA257_c62210 (fadB2)
   00380 Tryptophan metabolism
    USDA257_c62210 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    USDA257_c62210 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    USDA257_c62210 (fadB2)
   00281 Geraniol degradation
    USDA257_c62210 (fadB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    USDA257_c62210 (fadB2)
   00627 Aminobenzoate degradation
    USDA257_c62210 (fadB2)
   00930 Caprolactam degradation
    USDA257_c62210 (fadB2)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     USDA257_c62210 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6474325..6475098
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETRGRVGLITLNRPQALNALNSTLMRELDAALKTFDADKGVGAIVITGSDKA
FAAGADIKEMQSLDFVDSYLGDFLGGWEHVAGARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERAGLVARIV
APERLMEEALAAAEKIASLALPAVMMAKEAVNRSLEVTLAEGLRFERRLFQALFATEDQK
EGMAAFVGKRKADFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgctgctggtcgaaacgcgcgggcgcgtcggcctgatcaccctcaat
cggccgcaggcgctgaatgcgctgaattcgaccctgatgcgcgagcttgacgcggcgttg
aaaaccttcgatgcggacaagggcgtcggcgcgatcgtcatcaccggctcggacaaggca
ttcgcggccggcgccgatatcaaggaaatgcagtcgctcgatttcgtcgacagctacctt
ggcgactttctcgggggttgggagcatgtcgccggggcccgcaagccgatgattgcggcc
gtttccggctttgcgcttggcggcggctgcgagctcgccatgatgtgcgacttcatcatc
gcatcggagacggcgaaattcggtcaaccggaaatcaccctcggcgtcattcccggcatg
ggcgggtcgcagcgcctgacgcgcgcggtcggcaaagcgaaggcgatggacctgatcctg
accggccgcatgatggacgctgccgaggcggagcgggcgggcctcgttgcgcgcatcgtc
gcacccgagaggctgatggaagaggcgctcgccgcggcggaaaagatcgcctcgctcgcg
cttccggcggtgatgatggcgaaggaggcggtcaaccgctcgctggaagtgacgcttgcc
gagggcctccgtttcgagcggcggctcttccaggcgcttttcgccaccgaagaccagaag
gaagggatggccgccttcgtcggcaagcgcaaggcggatttcaaacacaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system