KEGG   Sinorhizobium fredii USDA 257: USDA257_c62210Help
Entry
USDA257_c62210    CDS       T02188                                 

Gene name
fadB2
Definition
(GenBank) putative enoyl-CoA hydratase FadB
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00071  Fatty acid degradation
sfd00280  Valine, leucine and isoleucine degradation
sfd00281  Geraniol degradation
sfd00310  Lysine degradation
sfd00360  Phenylalanine metabolism
sfd00362  Benzoate degradation
sfd00380  Tryptophan metabolism
sfd00410  beta-Alanine metabolism
sfd00627  Aminobenzoate degradation
sfd00640  Propanoate metabolism
sfd00650  Butanoate metabolism
sfd00903  Limonene and pinene degradation
sfd00930  Caprolactam degradation
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01212  Fatty acid metabolism
Module
sfd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    USDA257_c62210 (fadB2)
   00650 Butanoate metabolism
    USDA257_c62210 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    USDA257_c62210 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    USDA257_c62210 (fadB2)
   00310 Lysine degradation
    USDA257_c62210 (fadB2)
   00360 Phenylalanine metabolism
    USDA257_c62210 (fadB2)
   00380 Tryptophan metabolism
    USDA257_c62210 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    USDA257_c62210 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    USDA257_c62210 (fadB2)
   00281 Geraniol degradation
    USDA257_c62210 (fadB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    USDA257_c62210 (fadB2)
   00627 Aminobenzoate degradation
    USDA257_c62210 (fadB2)
   00930 Caprolactam degradation
    USDA257_c62210 (fadB2)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     USDA257_c62210 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFL54718
UniProt: I3XFR2
Position
6474325..6475098
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETRGRVGLITLNRPQALNALNSTLMRELDAALKTFDADKGVGAIVITGSDKA
FAAGADIKEMQSLDFVDSYLGDFLGGWEHVAGARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERAGLVARIV
APERLMEEALAAAEKIASLALPAVMMAKEAVNRSLEVTLAEGLRFERRLFQALFATEDQK
EGMAAFVGKRKADFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgctgctggtcgaaacgcgcgggcgcgtcggcctgatcaccctcaat
cggccgcaggcgctgaatgcgctgaattcgaccctgatgcgcgagcttgacgcggcgttg
aaaaccttcgatgcggacaagggcgtcggcgcgatcgtcatcaccggctcggacaaggca
ttcgcggccggcgccgatatcaaggaaatgcagtcgctcgatttcgtcgacagctacctt
ggcgactttctcgggggttgggagcatgtcgccggggcccgcaagccgatgattgcggcc
gtttccggctttgcgcttggcggcggctgcgagctcgccatgatgtgcgacttcatcatc
gcatcggagacggcgaaattcggtcaaccggaaatcaccctcggcgtcattcccggcatg
ggcgggtcgcagcgcctgacgcgcgcggtcggcaaagcgaaggcgatggacctgatcctg
accggccgcatgatggacgctgccgaggcggagcgggcgggcctcgttgcgcgcatcgtc
gcacccgagaggctgatggaagaggcgctcgccgcggcggaaaagatcgcctcgctcgcg
cttccggcggtgatgatggcgaaggaggcggtcaaccgctcgctggaagtgacgcttgcc
gagggcctccgtttcgagcggcggctcttccaggcgcttttcgccaccgaagaccagaag
gaagggatggccgccttcgtcggcaagcgcaaggcggatttcaaacacaggtga

DBGET integrated database retrieval system