KEGG   Sinorhizobium fredii USDA 257: USDA257_p01010Help
Entry
USDA257_p01010    CDS       T02188                                 

Gene name
pfkB
Definition
putative phosphofructokinase PfkB (EC:2.7.1.-)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    USDA257_p01010 (pfkB)
   01230 Biosynthesis of amino acids
    USDA257_p01010 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_p01010 (pfkB)
   00030 Pentose phosphate pathway
    USDA257_p01010 (pfkB)
   00051 Fructose and mannose metabolism
    USDA257_p01010 (pfkB)
   00052 Galactose metabolism
    USDA257_p01010 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    USDA257_p01010 (pfkB)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     USDA257_p01010 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pUSDA257_1:complement(80395..81357)
Genome map
AA seq 320 aa AA seqDB search
MPILAVALNPTIDVWSQAERVRPTVKIRTHSERQRPGGGGVNVARVIAELGGEPELLVLA
GGATGAMLREALATSAIRTHAVQIAGLTRISFMVREEETGLEYRFVPEGPEVAPGDIAKA
LAIVERFRGDFVVASGSLPRNAPEDIYADIGRIAAKTGARFILDCPGATLRSTLGKAPVF
LVKPSIEELETLAGRRLDENGVAQAASALVKETAAEFVAVTMGREGALLAGAFGVLRVPS
KHVVAKSTVGAGDSFIGALTWLLAEGRSIEEAFRFGVAAGAAAVIASGTELCRRNDVFKI
YNGTEPPPGVPSTSIESSGP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccttgcagtggctctcaaccccaccatcgacgtatggagtcaggctgagcgg
gtgcgtccgaccgttaagatccgtacgcacagcgagcggcaacgaccgggcggcggcggc
gtcaatgtcgcacgcgtcatcgccgagctcggcggcgagccggagctcctcgtcctcgcg
ggcggagcgactggagccatgcttagagaggcccttgcgacatcagccattcgaactcac
gccgtgcagatagcagggctgacgcgaatttcctttatggttcgggaagaggaaacgggg
ctcgaatatcgcttcgttcccgaagggccggaagtcgcgccgggcgacatcgcgaaggcg
cttgcgatcgttgagaggttcaggggcgacttcgtggtggccagcgggagtctgccgcgc
aacgctcccgaagacatctatgctgacattggccgcatagccgcgaaaaccggcgccagg
ttcattctcgactgcccgggggcgacattgcgcagcaccttgggcaaggcaccggttttc
ctcgtcaaaccgagcattgaagagttggaaacactggccggccggcgtctggacgagaat
ggggtcgcgcaagccgcatcggctttggtgaaggaaactgcagcagagttcgttgcagtc
actatgggccgcgagggtgccctcttggctggagccttcggcgttttacgcgtcccgtct
aagcacgtcgtcgccaagtccaccgtgggtgccggcgacagcttcattggcgcgctcact
tggttgctggcggaaggcaggtcaattgaggaggcgttccggtttggtgtcgccgcggga
gcagccgccgtcatcgcatccggaaccgagctgtgccggcgcaacgacgtctttaagatt
tacaacgggaccgaaccgcctccaggcgtgccgtcgacgtccatcgaaagctccggtcca
tga

DBGET integrated database retrieval system