KEGG   Sinorhizobium fredii USDA 257: USDA257_p05710Help
Entry
USDA257_p05710    CDS       T02188                                 

Gene name
hutG
Definition
formimidoylglutamase HutG (EC:3.5.3.8)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    USDA257_p05710 (hutG)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     USDA257_p05710 (hutG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pUSDA257_10:6081..6911
Genome map
AA seq 276 aa AA seqDB search
MPFDFAVSHRPGCRFGPEKILSALNTLSAYCVDKRVSLDKTSFVECGSVDALHSLEQSYS
NIRAAIAALPRRLLPIVLGGDHSITDPAIRGVRDRLSGAPMGLIVFDAHFDSREPIPGKE
HSGHWMRTLSDVIDYRKVVQMGINAAIYSEAYMREAEAAGVLVMTPYDIRRVGWTVALRT
AIEHGTADGAGVYISVDIDGIDQAYAPGTSVPNCGGLLAHEVLDAVFEIAVNAPTLALDI
TEVSPPLDRDDMTSRLAAQIIMNFMAGVVRQTSSGT
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgccgttcgactttgcggtcagtcatcgccctggttgtcgtttcggtcccgagaaaatt
ctttcggcactcaatacgttaagcgcatattgcgtcgacaagcgggtgtcgttggacaag
acgtccttcgtagagtgtggatcggtcgatgcgctgcactctctcgagcagtcatactca
aacattcgagctgccattgccgcactgccgcgcagattattgccaatagtcttgggtggt
gaccactctattaccgacccagcgatacggggtgttcgtgataggctttctggggcgcca
atggggctgattgtttttgacgcccatttcgattcgcgcgaaccaataccaggcaaggag
cattccgggcattggatgcggacgctgtcggacgtgattgactatcgcaaggttgtccag
atgggaatcaacgctgcgatttattcagaggcatacatgcgcgaggccgaagcagccggg
gtcctggtgatgacaccttacgacatacgtcgagtaggttggactgtcgctctgagaacc
gcaatcgagcatgggaccgctgatggggccggagtatacatctccgtcgacattgatggc
atcgaccaggcctatgcgccgggtacgagcgttcccaattgcggtggtcttcttgcccat
gaggttttggatgcggtgttcgagatcgcggttaacgcaccaacgctcgctctcgacatc
actgaagtgagtccgcctttggaccgagatgatatgacctcgcgacttgcagcgcagatc
atcatgaacttcatggcgggtgttgtccgacaaacatcaagtgggacctag

DBGET integrated database retrieval system