KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0118Help
Entry
SFxv_0118         CDS       T01883                                 

Gene name
aceF
Definition
(GenBank) Pyruvate dehydrogenase dihydrolipoyltransacetylase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00010  Glycolysis / Gluconeogenesis
sfe00020  Citrate cycle (TCA cycle)
sfe00620  Pyruvate metabolism
sfe01100  Metabolic pathways
sfe01110  Biosynthesis of secondary metabolites
sfe01120  Microbial metabolism in diverse environments
sfe01130  Biosynthesis of antibiotics
sfe01200  Carbon metabolism
Module
sfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_0118 (aceF)
   00020 Citrate cycle (TCA cycle)
    SFxv_0118 (aceF)
   00620 Pyruvate metabolism
    SFxv_0118 (aceF)
Enzymes [BR:sfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SFxv_0118 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADA72460
UniProt: D2AHZ6
Position
123444..125324
Genome map
AA seq 626 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEATPAATPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAY
VKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIP
HVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSED
GQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQ
GGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHR
VIDGADGARFITIINNTLSDIRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccatctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcaccc
gcggctgcggcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgacaaggcttctatggaagttccggctccgtttgcaggtaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcgactccggcagcgacccct
gcaccagcagctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgattacc
gtagaaggcgataaagcttctatggaagttccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggttcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggctccggca
gcaaaagctgaagctccggctgcgaaagcggaaggcaaatctgaatttgctgaaaacgac
gcttacgttcacgcgaccccgctgatccgccgtctggcacgcgagtttggcgttaacctg
gcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagacgttcaggcttac
gtgaaagaagctatcaaacgtgcagaagcagctccggcggcgactggcggtggtatccct
ggcatgctgccgtggccgaaggtggacttcagcaagtttggcgaaatcgaagaagtggaa
ctgggccgtatccagaaaatttctggtgctaacctgagccgtaactgggtgatgatcccg
catgttacccacttcgacaaaaccgatatcaccgagctggaagcgttccgtaaacagcag
aacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggttgtcttcatcatg
aaagccgttgctgcagctcttgagcagatgcctcgcttcaatagttcgctgtcggaagac
ggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtggataccccgaac
ggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatcgagctgtctcgc
gagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcgggcgaaatgcag
ggcggttgcttcaccatctccagcatcggcggcctgggtactacccacttcgcgccgatt
gtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatggagccggtgtgg
aatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctccttcgaccaccgc
gtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaacacgctgtctgac
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system