KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0483aHelp
Entry
SFxv_0483a        CDS       T01883                                 

Gene name
tesA-1
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sfe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(473323..473646)
Genome map
AA seq 107 aa AA seqDB search
MRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVP
LLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system