KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0483aHelp
Entry
SFxv_0483a        CDS       T01883                                 

Gene name
tesA-1
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SFxv_0483a (tesA-1)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SFxv_0483a (tesA-1)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SFxv_0483a (tesA-1)
Lipid biosynthesis proteins [BR:sfe01004]
 Fatty acid synthase
  Component type
   SFxv_0483a (tesA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(473323..473646)
Genome map
AA seq 107 aa AA seqDB search
MRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVP
LLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system