KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0762Help
Entry
SFxv_0762         CDS       T01883                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Brite
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SFxv_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736638..737171
Genome map
AA seq 177 aa AA seqDB search
MSAKIKYGLSAAVLALIAAGASAPQILDQFLNEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDVGRDCRIRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaaaatcaaatacggcctgtcggctgctgttctggcgctgattgccgcaggc
gcgtctgctccccagatacttgaccagtttctgaacgaaaaagagggtaatcacacaacg
gcataccgtgatggttctggcatatggaccatctgtcgtggtgccacaatggtggatggt
aagcctgtcataccgggaatgaagctgtcgaaggaaaaatgtgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtacctctgaccgaaccc
cagaaagcgggtatagcgtcattttgcccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggcgcatgcgaggcgattcgc
tggtggataaaagatgttgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcaatga

DBGET integrated database retrieval system