KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1487Help
Entry
SFxv_1487         CDS       T01883                                 

Gene name
ycjM-1
Definition
putative glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SFxv_1487 (ycjM-1)
Enzymes [BR:sfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SFxv_1487 (ycjM-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418153..1419283
Genome map
AA seq 376 aa AA seqDB search
MKQKITDYMDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPIFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQLPGFEDFFIAVDPKTDLSAVTLPRALPLLTPFQ
MDDNSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDDVAPGTVIITETNVPHKDNIAYFGNGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCQWAQSLSLPSSKTTWFNFLASHDGIGLNPLRGLLPESEILALVEA
LQQEGALVGNAANLLI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacatggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagt
aatgatttaaaaccactacccatatttaatcagttctaccatcaatggctgcaaagcatt
ttttcacatgttcatttattacctttttacccatggtcatctgatgatggattttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtctgcaaaaagtgaatgg
tttaaaaactatttacaacagcttccgggttttgaagatttctttattgcggttgatccg
aaaaccgatctcagtgccgtcacccttccgcgtgcgttaccgctattaacgccgtttcaa
atggatgataattccacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttgctggcgatggtggatgttttactctgttaccttgag
aaaggtgctgagtatgtccgcctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaagctgttacggtcgattattgat
gacgtagcaccaggtacagtgattattaccgaaaccaatgttccgcacaaagacaacatt
gcttactttggcaacggtgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgttacatgcggtgcaaaaacagaacgtcgaggcgctgtgccagtgggcgcaaagt
ctgagcttgccctccagtaaaacgacctggtttaacttcctcgcctctcacgatggcatc
gggttgaacccactgcgtggcttgcttccagaaagcgaaatattagcgctggtcgaggca
ttacagcaggaaggtgcattagtaggtaatgctgccaacttactgatttag

DBGET integrated database retrieval system