KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1641Help
Entry
SFxv_1641         CDS       T01883                                 

Gene name
pncA
Definition
Pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sfe00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552402..1553043)
Genome map
AA seq 213 aa AA seqDB search
MPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLGGLRQTFWPEHCVQNSEGAQLHPLLNQKEIAAVFHKGENPLVDSY
SAFFDNGRRQKTALDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtaccggaaggtgacagtacggtggaggttgctaaccgccttattgactggtgc
cagtcgcgcggagaagcggttatcgccagccaggactggcatccggcgaatcacggcagc
tttgccagccagcacggcgtagagccttatacgccaggccaactcggcggcctgcggcaa
actttctggcctgaacactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aatcaaaaagagatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggacgtcggcagaaaaccgcgcttgatgactggttgcgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtaaacgtgattaccgatggctgtcgtggc
gtgaatatccagccccaggacagtgcacacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagagacgcaggggtaa

DBGET integrated database retrieval system