KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1690Help
Entry
SFxv_1690         CDS       T01883                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFxv_1690 (pfkB)
   01230 Biosynthesis of amino acids
    SFxv_1690 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_1690 (pfkB)
   00030 Pentose phosphate pathway
    SFxv_1690 (pfkB)
   00051 Fructose and mannose metabolism
    SFxv_1690 (pfkB)
   00052 Galactose metabolism
    SFxv_1690 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SFxv_1690 (pfkB)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SFxv_1690 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594749..1595462)
Genome map
AA seq 237 aa AA seqDB search
MADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGA
ILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIGNIELVKPNQKELS
ALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTV
GAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKIYAYLSR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttggcggatgaaaatgtccccgtcgctactgtagaagccaaagactggacccggcagaat
ttacacgtacatgtggaagcaagcggtgaacagtatcgttttgttatgccaggcgcggca
ttaaatgaagatgagtttcgccagcttgaagagcaagttctggaaattgaatccggggcc
atcctggtcataagcggaagcctgccgccaggtgtgaagctggaaaaattaacccaactg
atttccgctgcgcaaaaccaagggatccgctgcatcatcgacagttctggcgaagcgtta
agtgcagcactggcgattggtaacatcgagttggttaagcctaaccaaaaagaactcagt
gcgctggtgaatcgcgaactcacccagccagacgatgtccgcaaagccgcgcaggaaatc
gttaatagcggcaaggccaaacgggttgtcgtttcccttggtccacaaggagcgctgggt
gtcgatagtgaaaactgcattcaggtggtgccaccaccggtgaaaagccagagtaccgtt
ggcgctggtgacagcatggtcggcgcgatgacactgaaactggcagaaaatgcctctctt
gaagagatggtccgttttggcgtagctgcggggagtgcagccacactcaatcagggaaca
cgtctgtgctcccatgacgatacgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system