KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1690Help
Entry
SFxv_1690         CDS       T01883                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00010  Glycolysis / Gluconeogenesis
sfe00030  Pentose phosphate pathway
sfe00051  Fructose and mannose metabolism
sfe00052  Galactose metabolism
sfe00680  Methane metabolism
sfe01100  Metabolic pathways
sfe01110  Biosynthesis of secondary metabolites
sfe01120  Microbial metabolism in diverse environments
sfe01130  Biosynthesis of antibiotics
sfe01200  Carbon metabolism
sfe01230  Biosynthesis of amino acids
Module
sfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_1690 (pfkB)
   00030 Pentose phosphate pathway
    SFxv_1690 (pfkB)
   00051 Fructose and mannose metabolism
    SFxv_1690 (pfkB)
   00052 Galactose metabolism
    SFxv_1690 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SFxv_1690 (pfkB)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SFxv_1690 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ADA73894
UniProt: D2AFJ1
Position
complement(1594749..1595462)
Genome map
AA seq 237 aa AA seqDB search
MADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGA
ILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIGNIELVKPNQKELS
ALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTV
GAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKIYAYLSR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttggcggatgaaaatgtccccgtcgctactgtagaagccaaagactggacccggcagaat
ttacacgtacatgtggaagcaagcggtgaacagtatcgttttgttatgccaggcgcggca
ttaaatgaagatgagtttcgccagcttgaagagcaagttctggaaattgaatccggggcc
atcctggtcataagcggaagcctgccgccaggtgtgaagctggaaaaattaacccaactg
atttccgctgcgcaaaaccaagggatccgctgcatcatcgacagttctggcgaagcgtta
agtgcagcactggcgattggtaacatcgagttggttaagcctaaccaaaaagaactcagt
gcgctggtgaatcgcgaactcacccagccagacgatgtccgcaaagccgcgcaggaaatc
gttaatagcggcaaggccaaacgggttgtcgtttcccttggtccacaaggagcgctgggt
gtcgatagtgaaaactgcattcaggtggtgccaccaccggtgaaaagccagagtaccgtt
ggcgctggtgacagcatggtcggcgcgatgacactgaaactggcagaaaatgcctctctt
gaagagatggtccgttttggcgtagctgcggggagtgcagccacactcaatcagggaaca
cgtctgtgctcccatgacgatacgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system