KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1760Help
Entry
SFxv_1760         CDS       T01883                                 

Gene name
yneH
Definition
(GenBank) Glutaminase 2
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00220  Arginine biosynthesis
sfe00250  Alanine, aspartate and glutamate metabolism
sfe00471  D-Glutamine and D-glutamate metabolism
sfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFxv_1760 (yneH)
   00220 Arginine biosynthesis
    SFxv_1760 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SFxv_1760 (yneH)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SFxv_1760 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: ADA73966
UniProt: D2AFR3
Position
1656316..1657242
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINTGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacagtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccgttcaattct
ttagtgcaactggaaatggaacagggtattccgcgtaatccgttcattaataccggtgcg
ctggtggtctgcgatatgttgcaagggcgactaagcgcaccacggcaacgtatgctggaa
gtcgtgcgcggcttaagcggtgtgtctgatatttcatacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggctaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agtggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcgaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgcagtctggagt
ccggaactggatgatgcaggtaactcgcttgcgggtatcgccgtccttgaacaattgacg
aaacagttagggcgttcggtttattaa

DBGET integrated database retrieval system