KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1955Help
Entry
SFxv_1955         CDS       T01883                                 

Gene name
adhP
Definition
putative Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SFxv_1955 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_1955 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SFxv_1955 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SFxv_1955 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SFxv_1955 (adhP)
   00626 Naphthalene degradation
    SFxv_1955 (adhP)
Enzymes [BR:sfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SFxv_1955 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1836965..1837975
Genome map
AA seq 336 aa AA seqDB search
MKTAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMEEE
CIVVADYAVKVPDGLDSAAPSSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMDADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggaggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcgccc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
cccggtcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcaaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatggatgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgtcactaa

DBGET integrated database retrieval system