KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_2341Help
Entry
SFxv_2341         CDS       T01883                                 

Gene name
galF
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00040  Pentose and glucuronate interconversions
sfe00052  Galactose metabolism
sfe00500  Starch and sucrose metabolism
sfe00520  Amino sugar and nucleotide sugar metabolism
sfe01100  Metabolic pathways
sfe01130  Biosynthesis of antibiotics
Module
sfe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SFxv_2341 (galF)
   00052 Galactose metabolism
    SFxv_2341 (galF)
   00500 Starch and sucrose metabolism
    SFxv_2341 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SFxv_2341 (galF)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SFxv_2341 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ADA74479
UniProt: D2A6X1
Position
complement(2173363..2174256)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVIIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtctcgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccaatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgagttagaatcactccttgagcagcgc
gtgaagcgtcaactgctggcggaagtacagtccatctgtccgccgggcgtgatcattatg
aacgtgcgtcagggcgaacctttaggtttaggccactccattttgtgtgcgcgacctgcc
attggtgacaacccatttgtcgtggtactgccagacgttgtgatcgacgatgccagcgcc
gacccgctacgttacaaccttgctgccatgattgcacgtttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagactaaa
gagccgctggaccgtgagggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgtaggtcgctatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gctattgccgagctggcgaaaaaacaatccgttgatgcaatgctgatgaccggcgacagt
tacgactgcggcaaaaaaatgggctatatgcaggcgtttgtgaagtatggcctacgcaac
ctgaaagaaggggcgaagttccgtaaaggtattgagaagctgttaagcgaataa

DBGET integrated database retrieval system