KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_2675Help
Entry
SFxv_2675         CDS       T01883                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00052  Galactose metabolism
sfe00500  Starch and sucrose metabolism
sfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SFxv_2675
   00500 Starch and sucrose metabolism
    SFxv_2675
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SFxv_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: ADA74775
UniProt: D2AG53
Position
2517004..2518437
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPMS
EHWGPMHWGHATSDDMIHWQHEPIALALGDDNDKDGCFSGSAVDDNGVLSLIYTGHVWLD
GAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGAKDP
GNTGQILLYRGSSLREWAFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNAEGY
SYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDMWES
PMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSVSPRRISNKYVLQENAQ
AVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLILWRYYPHENLDGYRSIPLPQRD
TLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVLQHGALWLLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcatgagcaccgg
ggtaacactttctatccccattttcacctcgcgcctcctgccggatggatgaacgatcca
aacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcacccgatgagc
gaacactggggaccaatgcactggggacatgccaccagtgacgatatgatccactggcag
catgagcctattgcgctagcgctaggagacgataatgacaaagacgggtgtttttcaggt
agtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtctggctcgat
ggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagtcgggatggt
attcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatgcacttccgc
gatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcgaaagatcca
ggcaacacggggcagatcctgctttatcgcggcagttcattgcgtgaatgggccttcgat
cgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccggactttttc
agccttggcgatcagcattatctgatgttttccccgcagggaatgaatgccgagggatac
agttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgccaggacgactt
tttgcacaatccgggcattttactgaacttgataacgggcatgacttttatgcaccacaa
agctttttagcgaaggatggtcggcgtattgttatcggctggatggatatgtgggaatcg
ccaatgccctcaaaacgtgaaggatgggcaggctgcatgacgctggcgcgcgagctatca
gagagcaatggcaaacttctacaacgcccggttcacgaagctgagtcgttacgccagcag
catcaatctgtctctccccgcagaatcagcaataaatatgttttgcaggaaaacgcgcaa
gcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacattacggatta
cagctcggcactggaatgcggctgtatattgataaccaatctgagcgacttattttgtgg
cggtattacccacacgagaatttagacggctaccgtagtattcccctcccgcagcgtgac
acgctcgccctaaggatatttatcgatacatcatccgtggaagtatttattaacgacggg
gaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactgtcgctttat
gcctcccacggagtggctgtgctgcaacatggagcactctggctactgggttaa

DBGET integrated database retrieval system