KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3636Help
Entry
SFxv_3636         CDS       T01883                                 

Gene name
rsmB
Definition
Ribosomal RNA small subunit methyltransferase B
Orthology
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Brite
Enzymes [BR:sfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     SFxv_3636 (rsmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3457100..3458410
Genome map
AA seq 436 aa AA seqDB search
MPSIFILMKKQRNLRSMAAQAVEQVVEQGQSLSNILPPLQQKVSDKDKALLQELCFGVLR
TLSQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ
LKGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPP
MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA
SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRIYDNLKRL
GMKATVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQ
SEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNQP
GAEEGDGFFYAKLIKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgccgagcatttttatacttatgaaaaaacaacgtaatttacgtagcatggcggcccag
gccgttgaacaagtcgtcgagcaagggcaatcattaagcaacattctgccaccgctccag
caaaaagtttccgataaagacaaagcacttcttcaagagttgtgctttggcgtactgcgt
acgctttcgcagttagactggctgattaataagttaatggcccgtccgatgaccggcaaa
cagcgcactgtgcattacctgattatggttggtttgtatcaactgctttatacccgcatt
ccacctcatgctgcgctggctgaaacggttgaaggcgctatcgcaattaagcgtccgcaa
cttaaagggttgattaacggtgtattacgccagttccagcgtcggcaagaagagttatta
gccgagtttaatacccgtgatgcacgttatctgcatccttcctggttgctgaagcgtctg
caaaaagcgtatccagagcagtggcaatccatcgccgaagccaataaccagcgtccgcca
atgtggctgcgtattaatcgtacgcatcattcccgcgacagctggcttgcattgctggat
gaagcaggaatgaaaggtttcccgcatgcggattaccctgatgctgtacggctggaaaca
cctgcacctgttcatgcgctacctggttttgaagacggatgggttaccgttcaggatgca
tcagcacaaggttgcatgacctggcttgcgccacaaaacggtgaacacatcttggatctt
tgtgccgcccccggcggtaaaacaacgcatatccttgaggtggcaccagaagcgcaggtt
gttgcggttgatattgacgaacagcgcctctctcgcatttacgacaatttaaaacgcctt
ggtatgaaggcaaccgtgaaacaaggtgatggccgttacccttcccaatggtgtggcgag
caacagtttgatcgcattttattagatgcgccttgttcagcaacgggggtgattcgtcgc
catccagatattaaatggttacgtcgcgatcgcgatatcccggaactcgcgcaattgcag
tctgaaattctcgacgccatttggccgcatttaaaatccggtggaaccctggtctatgcc
acctgttcggtgttaccggaagagaatagcctgcagattaaagcctttttgcaacgtacc
gctgatgccgaactttgcgaaacaggaacaccagagcaaccgggtaaacaaaatcagcct
ggtgccgaagagggcgacggcttcttttacgctaagctaatcaaaaagtga

DBGET integrated database retrieval system