KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4016Help
Entry
SFxv_4016         CDS       T01883                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SFxv_4016 (gmk)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SFxv_4016 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3823887..3824567
Genome map
AA seq 226 aa AA seqDB search
MYNKLVCRLYFANHIRKILMAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTT
RQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFL
DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYA
EYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgtataataagctcgtatgtaggctttatttcgctaatcacatacgaaagatactcatg
gctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctgatt
caggctttattaaaaacccaaccgttgtatgacacccaggtttctgtttcacacaccaca
cgccaaccgcgtcctggtgaagtccacggtgaacattatttctttgttaatcatgatgaa
tttaaagaaatgattagcagagatgcgttcctcgaacacgcagaagtttttggtaattac
tatggcacttcgcgtgaggccattgagcaagtactggcgaccggtgtcgatgtttttctc
gatatcgactggcagggcgcgcagcaaattcgccagaagatgccgcacgcgcggagtatc
tttattttaccgccgtccaaaattgaactggaccgccgtctacgcggtcgcggtcaggac
agcgaagaggtcattgcaaagcgtatggcgcaagctgttgcagaaatgagccattacgcc
gaatatgattatctgattgtgaatgatgacttcgataccgcgttgaccgatttgaagacc
attattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgctttaatc
agcaaattgttggcagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system