KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4069Help
Entry
SFxv_4069         CDS       T01883                                 

Gene name
bglB
Definition
(GenBank) Phospho-beta-glucosidase B cryptic
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00010  Glycolysis / Gluconeogenesis
sfe00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_4069 (bglB)
   00500 Starch and sucrose metabolism
    SFxv_4069 (bglB)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SFxv_4069 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: ADA76040
UniProt: D2AB54
Position
3876373..3877422
Genome map
AA seq 349 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWLEDGKGITTSDLQPHGVMGKMEPRILGKENIKDVAID
FYYRYPEDIALFAEMGFTCLRISIAWARIFPQGDEAEPNEAGLAFYDRLFDEMAQAGIKP
LVTLSHYEMLYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHAP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKAYHSLIPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDPVGLRVMLPTY
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggcgcaacagctgccaatcaggtggaa
ggtgcctggctggaagatggcaaagggatcacgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttattaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaattttccctcagggcgacgaagccgaaccgaatgaa
gcggggttagcgttttacgatcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgctatatgggctggtgaaaaactacggcggttgg
gctaatcgggcggtcatcgatcacttcgagcattacgcccgcacggtctttacccgctac
caacataaagtagcgttatggctgacgtttaatgaaatcaatatgtcgttacacgcgcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggcgatccat
catcaactggttgccagtgcgcgggcagttaaagcctatcatagcctgatccccgaagcg
aaaatcggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggccaatatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacatactgtagatttcatctcttttagttattac
atgactggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatccccaatccgcatctgaaaagttcagagtgggggtggcaaattgatccggtt
ggattacgggtaatgctgccaacttactga

DBGET integrated database retrieval system