KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4180Help
Entry
SFxv_4180         CDS       T01883                                 

Definition
putative Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SFxv_4180
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SFxv_4180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3986495..3987439
Genome map
AA seq 314 aa AA seqDB search
MDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAG
ANAALSPSLVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPD
ELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNG
EGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSV
PWREEIDAFLDRQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggcagcattaatgct
gaccacattcttaatcttcaatcttttcctactccaggcgaaaccgtaaccggtaaccac
tatcaggttgcatttggcggcaaaggcgcgaatcaggctgtggctgctgggcgtagcggt
gcgaatatcgcgtttattgcctgtactggcgatgacagcattggcgagagcgttcgccag
cagctcgccactgataacatcgatattactccggtcagcgtgatcaaaggcgaatcaaca
ggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcatcggtattcatgccggc
gctaatgctgctctttccccatcgctggtggaagcgcaacgtgagcgtattgccaacgcg
tcagcgttattaatgcagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatc
gcccatcaaaataagactatcgttgcgcttaacccggctccggctcgcgaacttcctgac
gaactgctggcgctggtggacattattacgccaaacgaaacggaagcagaaaagctcacc
ggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaag
ggtatccgtactgtactgattactttaggaagtcgtggtgtatgggctagcgtgaatggt
gaaggtcagcgcgttcctggattccgggtgcaggctgtcgataccattgctgccggagat
acctttaacggcgcgttaatcacggcgttgctggaagaaaaaccattgccagaggcgatt
cggtttgcccatgctgccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgta
ccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system