KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4355Help
Entry
SFxv_4355         CDS       T01883                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFxv_4355 (pfkA)
   01230 Biosynthesis of amino acids
    SFxv_4355 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFxv_4355 (pfkA)
   00030 Pentose phosphate pathway
    SFxv_4355 (pfkA)
   00051 Fructose and mannose metabolism
    SFxv_4355 (pfkA)
   00052 Galactose metabolism
    SFxv_4355 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SFxv_4355 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SFxv_4355 (pfkA)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SFxv_4355 (pfkA)
Protein phosphatases and associated proteins [BR:sfe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SFxv_4355 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4162148..4163170
Genome map
AA seq 340 aa AA seqDB search
MCKKTSGNRFHFAFQSSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYD
GYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVV
IGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSS
HQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVA
ITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGY
GGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaagaagacttccggcaacagatttcattttgcattccaaagttcagaggtagtc
atgattaagaaaataggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggtatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtgtctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtggtatcgacgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggtctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgaccctggct
gcggccattgccggtggctgtgaattcgttgtagttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggcggtcgttgtgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system