KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4478Help
Entry
SFxv_4478         CDS       T01883                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfe00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfe00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4305999..4307354)
Genome map
AA seq 451 aa AA seqDB search
MMSAPKITFIGAGSTIFVKNILGDVFHREALKTAHIALMDIDPTRLEESHIVVRKLMDSA
GASGKITCHTQQKEALEDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWQICENMTEVCPDATMLNYVNPMAMNTWAMYARYPYIKQVGLCHSVQGTA
EELARDLNIDPATLRYRCAGINHMAFYLELERKTADGSYVNLYPELLAAYEAGQAPKPNI
HGNTRCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKLGREDLIERYKVPLDEYPKRCV
EQLANWHKELEEYKNASRIDIKPSREYASTIMNAIWTGEPSVIYGNVRNDGLIDNLPQGC
CVEVACLVDANGIQPTKVGTLPSHLAALMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIDEIYALVDDLIAAHGDWLPSWLHR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgcacccaaaattacatttatcggcgctggttcgacgattttcgttaaaaat
attcttggtgatgtgttccatcgcgaggcgctgaaaacggcgcatattgccctgatggac
attgaccccacccgcctggaagagtcgcatattgtggtgcgtaagctgatggattcagca
ggggccagcggcaaaatcacctgccacacccaacagaaagaagccttagaggatgccgat
tttgtcgtggtggcatttcagattggcggttatgaaccttgcacggtgactgatttcgag
gtctgtaagcggcatggtctggaacaaaccattgccgatacgttggggccgggcggtatt
atgcgcgcgctacgtaccattccgcatctgtggcaaatttgcgagaacatgacggaagtc
tgccccgatgccaccatgctcaactatgttaacccaatggcgatgaatacctgggcgatg
tatgcccgctatccgtatatcaaacaggtcgggctgtgccattcggtgcagggaacggcg
gaagagctggcgcgtgacctcaatatcgacccggctacgctgcgttaccgttgcgcaggt
atcaaccatatggcgttttacctggagctggagcgcaaaaccgccgacggcagttacgtg
aatctctacccggaactgctggcggcttatgaagcagggcaggcaccgaagccaaatatt
catggtaatactcgctgccagaatattgtgcgctacgaaatgttcaaaaagctgggctac
ttcgtcacggaatcatcagaacattttgccgaatatacgccgtggtttattaagctaggt
cgtgaggatttgattgagcgttataaagtaccgctggatgagtacccgaaacgctgcgtc
gagcagctggcgaactggcataaagagctggaggagtataaaaacgcctcccggattgat
attaaaccgtcacgggaatatgccagcacaatcatgaacgctatctggactggcgagccg
agtgtgatttacggcaacgtccgtaacgatggtttgattgataacctgccacaaggatgt
tgcgtggaagtagcctgtctggttgatgctaatggcattcagccgaccaaagtcggtacg
ctaccttcgcatctggccgccctgatgcaaaccaacatcaacgtacagacgctgctgacc
gaagctattcttacggaaaatcgcgaccgtgtttaccacgccgcgatgatggacccgcat
actgccgccgtgctgggcattgacgaaatatatgctcttgttgacgacctgattgccgcc
cacggcgactggctgccaagctggttgcaccgttaa

DBGET integrated database retrieval system