KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4807Help
Entry
SFxv_4807         CDS       T01883                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SFxv_4807 (deoA)
Enzymes [BR:sfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SFxv_4807 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4628534..4629856
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG
MAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVILAKDENSWQEAAKAVKAA
IKLADNAPESTPTVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagcgatgaa
gaaattcgtttctttatcaacggtattcgcgacaacactatttccgaagggcagattgcc
gccctcgcgatgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgacc
atggcgatgcgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccg
attgttgataaacactcgaccggcggcgtcggcgatgtcacttcgctgatgttggggccg
atggtcgcagcctgcggcggctatattccgatgatctccggtcgcggcctcggtcatact
ggcggtacgctcgacaaactggaatccatccctggcttcgacattttcccggatgacaac
cgtttccgcgaaattattaaagacgtcggcgtggcgattatcggtcagaccagttcactg
gctccggctgataaacgtttctacgcgacccgtgatattaccgcaaccgtggactccatc
ccgctgatcactgcctcgatcctggcgaagaaactggcggaaggtctggacgcgctggtg
atggacgtgaaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagccctt
gccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcacc
gacatgaatcaggtactggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtg
cagttcctgacgggtgagtatcgtaacccgcgtctgtttgatgtcacgatggcgctgtgc
gtggagatgttgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattg
caggcggtgctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaa
aaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacg
aaagcagtctatgctgataccgaaggttttgtcagtgaaatggatacccgcgcgctgggg
atggcagtagttgcaatgggcggcggtcgtcgtcaggcatctgacaccatcgattacagc
gtcggctttactgatatggcgcgtctgggcgaccaggtagacggtcagcgtccgctggcg
gttatcctcgcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggca
attaaacttgccgataacgcaccggaaagcacaccaactgtctatcgccgtatcagcgaa
taa

DBGET integrated database retrieval system