KEGG   Sinorhizobium fredii HH103: SFHH103_00054Help
Entry
SFHH103_00054     CDS       T01731                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SFHH103_00054
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SFHH103_00054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59140..60039)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTARLPKPGETVAGTGFSTAAGGKGANQALAARRAGASVRMAGAVG
SDSFAEGALALLKEAGTDLGLTKTVNEPTGTAHILVGGDGENVIVVVASANATVSEGDAS
TAVGKMSAGDTLMLQLEIPAASVEKALVEAKRRGIRSVINIAPLTPEAARLGRMADIVIA
NETEFELLAGKSGIAGAEREAAMKSLHDETGQTVIVTLGAEGVAAAHQGEIHRARGLTIE
PVDTVGAGDTFCGYLAASLDAGLAFPDALRRAAVAGSLACLKPGAQPSIPLASEVAARL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtttttgggtccatcaacatggacctgatcgccacgaccgcacgcctgccg
aagcccggcgagaccgtcgccgggaccggcttttccaccgccgccggcggcaagggcgcg
aaccaggccctggcggcccgtcgcgccggtgcttccgtgcggatggcaggcgccgtcggc
tcggacagcttcgccgaaggtgcgctcgctttgctcaaggaggccggcaccgacctcggc
ctcaccaagaccgtcaacgagccgaccggtaccgcccatatcctcgtcggcggcgatggc
gagaacgtcatcgtcgtcgtggcgagcgccaatgcgacggtgagcgagggcgatgccagc
actgccgtcgggaaaatgtcggccggcgacacgttgatgctgcagctcgagattcctgcg
gcctcggtggaaaaggcactcgtcgaggcaaagcgccgcggcatccgctcggtcatcaat
atcgcaccgctgacgcccgaggctgcccgtctcggccgcatggccgatatcgtgattgcc
aacgagaccgaattcgaactcctggccggcaagagcggcatcgccggcgccgaacgggag
gcggcgatgaagagccttcacgacgaaaccgggcagacggtgatcgtcacgctcggcgcc
gaaggggtcgccgccgctcatcagggcgaaatccatcgcgcccgggggctgaccatcgag
ccggtcgatacggtcggggcgggtgacaccttttgtggttatctcgctgcgagcctggac
gcgggcctcgccttccccgatgcgctgcgccgcgccgcggtcgccgggtcgctggcctgc
ctgaagccgggcgcgcaaccgtccattccgctcgcctccgaggtcgccgcgcgtctctga

DBGET integrated database retrieval system