KEGG   Sinorhizobium fredii HH103: SFHH103_00061Help
Entry
SFHH103_00061     CDS       T01731                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sfh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(65000..66193)
Genome map
AA seq 397 aa AA seqDB search
MFPTDPISNLAALIRCPSVTPDEGGALTALETMLAPLGFTVDRVVAKEAGTPDIENLYAR
LGTEGPHLMFAGHTDVVPVGDEAAWSHPPFSAAIAGGEMYGRGAVDMKGGIACFVAAVAR
HIEKHGRPKGSISFLITGDEEGPAINGTVKLLEWAAQKGERWDACLVGEPTNPESLGDMI
KIGRRGSLSGRIIVHGVQGHAAYPHLADNPVRGILQLAQALMDPAFDNGTEDFQPSNLEV
TTIDVGNPAVNVIPAKATAAFNIRFNDSWTAESLKAEIVARLDRAAKDETLRPGRQPVKY
DIVWNERPSHVFLTRNNALIDSLSGAIEAVTGRQPKLSTTGGTSDARFIKDYCPVVEFGL
VGQTMHMVDERVAVADLETLTGIYETFVARWFGHAAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaccgatccgatctccaatctcgccgccctcatccgttgcccatcggtcacc
ccggacgaaggcggggcgctcaccgctctggaaacgatgctggcgccgctcggcttcacg
gtcgatcgggtcgtggcgaaggaggcaggcacgccggatatcgagaacctctatgcccgg
ctcggcaccgaaggcccgcatctgatgttcgccggccacaccgatgtcgtgccggtcggc
gacgaagccgcctggtcccatccgccgttctccgccgcgatcgccggcggcgaaatgtac
gggcgtggcgccgtcgacatgaagggcggcattgcctgcttcgtcgcagccgtggcccga
cacatcgagaagcatggccgcccgaaaggctcgatctccttcctgatcaccggcgacgag
gaaggcccggcgatcaacgggacggtgaagcttctcgaatgggctgcccaaaaaggcgaa
cgctgggacgcctgcctcgtcggcgagccgaccaatccggagagcctcggcgacatgatc
aagatcggccggcgcggctcactgtccggccggatcatcgtgcacggcgtccagggccac
gccgcctatccgcaccttgccgacaatccggtgcgcggcattctgcagctcgcgcaagcg
ctgatggacccagccttcgacaatggcaccgaggatttccagccgtccaatctggaagtg
acgacgatcgacgtcggcaatcccgccgtcaacgtcattcccgcgaaggcgactgccgcc
ttcaacatccgcttcaacgatagctggacggccgaaagcctgaaggccgagatcgtcgcc
cgtctcgaccgcgccgcgaaggacgaaacgctccggcccggccggcagccggtcaaatac
gatatcgtctggaacgagcgcccgagccacgtcttcctgacgcgcaacaacgcgctgatc
gattcgctttccggcgcgatcgaggcggtgaccgggcgccagccgaagctctccaccacc
ggcggcacgtcggacgcccgcttcatcaaggactattgcccggtggtcgagttcggcctt
gtcggccagaccatgcacatggtcgacgaacgggtcgccgtcgccgatctcgagaccttg
accggaatctacgaaaccttcgttgcccgctggttcggccatgccgctgcttga

DBGET integrated database retrieval system