KEGG   Sinorhizobium fredii HH103: SFHH103_00188Help
Entry
SFHH103_00188     CDS       T01731                                 

Gene name
fadb1
Definition
putative fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_00188 (fadb1)
   01212 Fatty acid metabolism
    SFHH103_00188 (fadb1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFHH103_00188 (fadb1)
   00650 Butanoate metabolism
    SFHH103_00188 (fadb1)
  Lipid metabolism
   00071 Fatty acid degradation
    SFHH103_00188 (fadb1)
   01040 Biosynthesis of unsaturated fatty acids
    SFHH103_00188 (fadb1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFHH103_00188 (fadb1)
   00310 Lysine degradation
    SFHH103_00188 (fadb1)
   00380 Tryptophan metabolism
    SFHH103_00188 (fadb1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFHH103_00188 (fadb1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SFHH103_00188 (fadb1)
   00281 Geraniol degradation
    SFHH103_00188 (fadb1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SFHH103_00188 (fadb1)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SFHH103_00188 (fadb1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SFHH103_00188 (fadb1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SFHH103_00188 (fadb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(194451..196664)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPEKSMNVFTQEVMDELDAIVDQTTADAAVKGVVFTSGK
SSFSGGADLSMIKSMFTLQAEERKKDPANAAQKLFNLVGRMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVASNSKAVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTAARAKAMGLVHEVVEPEKLVEAAKAMIKNGLKPVQPWDEKGFKLPGGGVWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTGLKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTEFKTVGVIGAGFMGASIAYVTAAAGIPVTLIDRDME
AAEKGKAHSEGLVKDSVGKGRLTKEEGEALLSRITPSADYGDLKDAGLVVEAVFEDRQVK
KDVIEKVEAVIAPDAIFASNTSTLPITGLAKNSKRPEQFIGVHFFSPVEKMMLTEVIVGK
ETGDKALATALDYVAAIKKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKAVDPRHMALVNKMVDELDRRGRKNG
KGFYEYPAKPAKKYLWPELKTLYPQKAADKIDVEVVKQRFLATIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGTKAFVAMCNKLAKAYGDHFKPTPLLKEMAEKG
ETFYGRFDPYGEAPKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgccgacggcatcgcactcgtcacctgg
gacatgcccgagaagtcgatgaacgtcttcacgcaggaagtgatggacgaactcgatgcg
atcgtcgaccagacgaccgccgatgccgccgtcaagggcgtcgtcttcacctccggcaag
tcgtccttctccggcggcgccgacctctcgatgatcaagtcgatgttcacgctgcaggcc
gaggaaaggaagaaggatccggccaatgccgcgcagaagctcttcaacctcgtcggtcgc
atgaccgggctgttccgcaagctcgaaacctgcggcaagccctgggtctcggcaatcaac
ggcacctgcatgggcggtgccttcgaactgtcgctcgcctgccacggccgcgtcgcttcc
aattcgaaagcggtgaagatcgccctccccgaggtcaaggtcggcatcttcccgggcgcc
ggcggcacgcagcgcgtgccgcggctcaccaacacgcaggacgccctgcagatgatgacc
accggctcgtcgctgaccgcggcgcgcgccaaggcgatgggcctcgtgcatgaggtggtc
gaaccggagaagctggtcgaagccgccaaggcgatgatcaagaacgggctgaagcccgtg
cagccctgggacgagaagggcttcaagcttccgggcggcggcgtctggacgcctgcctcc
gcgcagctctggccggcagcgtccggcattctgcgccgcgaaacctacggcaactatccg
ggcgccatcgccatcctgaaatgcgtctatgagggcctgcaggtgccgttcgacaccggc
ttgaagatcgagcaacgctatttcaccgagattctgcagaccaccgaagccttctcgatg
atccgctcgctcttcgtctcgatgcaggagctcggcaaaggcgcacgccgtccggccggc
gtaccgaagacggagtttaagacggtcggcgtcatcggcgccggcttcatgggcgcctcg
attgcctatgtgacggccgccgccggcatcccggtcaccctcatcgaccgcgacatggaa
gcggccgaaaagggcaaggcgcattcggaagggctggtcaaggattcggtcggcaaggga
cggctgaccaaggaagagggcgaggcgctgctttcccgcatcacgccgtcggccgactat
ggcgatctcaaggacgccggcctcgtcgtcgaggcggtgttcgaggaccggcaggtcaag
aaggacgtgatcgagaaggtcgaggcggtcatcgccccggacgccatcttcgcctccaac
acctcgacgctgccgatcaccggccttgccaagaattcgaaacggccggagcagttcatc
ggcgtccatttcttctcgccggtcgagaagatgatgctgacggaagtgatcgtcggcaag
gagaccggcgacaaggcgctcgccacggcgctcgactatgtcgcggcgatcaagaagacg
ccgatcgtcgtcaacgacacccgcggcttctacgtcaaccgctgtgtcttccgctatatc
cacgaagcctatgacatgctgatcgagggcgtgccgccggcgatgatcgagaatgccgcc
aagatggccggcatgccggtcggtccgttgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctcaaggcgacggtagccgatctcggcgaaaaggccgtcgatccgcgc
cacatggcacttgtcaacaagatggtcgacgaactcgaccggcgcggccgcaagaacggc
aagggcttctacgaatacccggcgaaaccggcgaagaagtatctgtggccggagctgaag
acgctctatccgcagaaggcggccgacaagatcgacgtcgaggtggtgaagcagcgcttc
ctcgcgacgatcgcgctcgaagcggcccgcactatcgaggaaggcatcgtcaccgacccg
cgcgaggcggatgtcggctcgatcctcggcttcggcttcgctccctacaccggcggcacg
ctctcctatatcgacggcatgggcaccaaggctttcgtcgcgatgtgcaacaagctagcc
aaggcttatggcgaccacttcaagccgacgccgcttctgaaggagatggcagagaagggc
gagaccttctacggtcggttcgacccctacggggaggcgccgaaggcggcttag

DBGET integrated database retrieval system