KEGG   Sinorhizobium fredii HH103: SFHH103_00188Help
Entry
SFHH103_00188     CDS       T01731                                 

Gene name
fadb1
Definition
(GenBank) putative fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00071  Fatty acid degradation
sfh00280  Valine, leucine and isoleucine degradation
sfh00281  Geraniol degradation
sfh00310  Lysine degradation
sfh00362  Benzoate degradation
sfh00380  Tryptophan metabolism
sfh00410  beta-Alanine metabolism
sfh00640  Propanoate metabolism
sfh00650  Butanoate metabolism
sfh00903  Limonene and pinene degradation
sfh00930  Caprolactam degradation
sfh01040  Biosynthesis of unsaturated fatty acids
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
sfh01212  Fatty acid metabolism
Module
sfh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFHH103_00188 (fadb1)
   00650 Butanoate metabolism
    SFHH103_00188 (fadb1)
  Lipid metabolism
   00071 Fatty acid degradation
    SFHH103_00188 (fadb1)
   01040 Biosynthesis of unsaturated fatty acids
    SFHH103_00188 (fadb1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFHH103_00188 (fadb1)
   00310 Lysine degradation
    SFHH103_00188 (fadb1)
   00380 Tryptophan metabolism
    SFHH103_00188 (fadb1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFHH103_00188 (fadb1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SFHH103_00188 (fadb1)
   00281 Geraniol degradation
    SFHH103_00188 (fadb1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFHH103_00188 (fadb1)
   00930 Caprolactam degradation
    SFHH103_00188 (fadb1)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SFHH103_00188 (fadb1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SFHH103_00188 (fadb1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SFHH103_00188 (fadb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 FAD_binding_3 2-Hacid_dh_C UDPG_MGDP_dh_N F420_oxidored NAD_binding_8 ApbA Sacchrp_dh_NADP NAD_binding_7 GIDA NAD_Gly3P_dh_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CCE94692
UniProt: G9AAR2
Position
complement(194451..196664)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPEKSMNVFTQEVMDELDAIVDQTTADAAVKGVVFTSGK
SSFSGGADLSMIKSMFTLQAEERKKDPANAAQKLFNLVGRMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVASNSKAVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTAARAKAMGLVHEVVEPEKLVEAAKAMIKNGLKPVQPWDEKGFKLPGGGVWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTGLKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTEFKTVGVIGAGFMGASIAYVTAAAGIPVTLIDRDME
AAEKGKAHSEGLVKDSVGKGRLTKEEGEALLSRITPSADYGDLKDAGLVVEAVFEDRQVK
KDVIEKVEAVIAPDAIFASNTSTLPITGLAKNSKRPEQFIGVHFFSPVEKMMLTEVIVGK
ETGDKALATALDYVAAIKKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKAVDPRHMALVNKMVDELDRRGRKNG
KGFYEYPAKPAKKYLWPELKTLYPQKAADKIDVEVVKQRFLATIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGTKAFVAMCNKLAKAYGDHFKPTPLLKEMAEKG
ETFYGRFDPYGEAPKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgccgacggcatcgcactcgtcacctgg
gacatgcccgagaagtcgatgaacgtcttcacgcaggaagtgatggacgaactcgatgcg
atcgtcgaccagacgaccgccgatgccgccgtcaagggcgtcgtcttcacctccggcaag
tcgtccttctccggcggcgccgacctctcgatgatcaagtcgatgttcacgctgcaggcc
gaggaaaggaagaaggatccggccaatgccgcgcagaagctcttcaacctcgtcggtcgc
atgaccgggctgttccgcaagctcgaaacctgcggcaagccctgggtctcggcaatcaac
ggcacctgcatgggcggtgccttcgaactgtcgctcgcctgccacggccgcgtcgcttcc
aattcgaaagcggtgaagatcgccctccccgaggtcaaggtcggcatcttcccgggcgcc
ggcggcacgcagcgcgtgccgcggctcaccaacacgcaggacgccctgcagatgatgacc
accggctcgtcgctgaccgcggcgcgcgccaaggcgatgggcctcgtgcatgaggtggtc
gaaccggagaagctggtcgaagccgccaaggcgatgatcaagaacgggctgaagcccgtg
cagccctgggacgagaagggcttcaagcttccgggcggcggcgtctggacgcctgcctcc
gcgcagctctggccggcagcgtccggcattctgcgccgcgaaacctacggcaactatccg
ggcgccatcgccatcctgaaatgcgtctatgagggcctgcaggtgccgttcgacaccggc
ttgaagatcgagcaacgctatttcaccgagattctgcagaccaccgaagccttctcgatg
atccgctcgctcttcgtctcgatgcaggagctcggcaaaggcgcacgccgtccggccggc
gtaccgaagacggagtttaagacggtcggcgtcatcggcgccggcttcatgggcgcctcg
attgcctatgtgacggccgccgccggcatcccggtcaccctcatcgaccgcgacatggaa
gcggccgaaaagggcaaggcgcattcggaagggctggtcaaggattcggtcggcaaggga
cggctgaccaaggaagagggcgaggcgctgctttcccgcatcacgccgtcggccgactat
ggcgatctcaaggacgccggcctcgtcgtcgaggcggtgttcgaggaccggcaggtcaag
aaggacgtgatcgagaaggtcgaggcggtcatcgccccggacgccatcttcgcctccaac
acctcgacgctgccgatcaccggccttgccaagaattcgaaacggccggagcagttcatc
ggcgtccatttcttctcgccggtcgagaagatgatgctgacggaagtgatcgtcggcaag
gagaccggcgacaaggcgctcgccacggcgctcgactatgtcgcggcgatcaagaagacg
ccgatcgtcgtcaacgacacccgcggcttctacgtcaaccgctgtgtcttccgctatatc
cacgaagcctatgacatgctgatcgagggcgtgccgccggcgatgatcgagaatgccgcc
aagatggccggcatgccggtcggtccgttgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctcaaggcgacggtagccgatctcggcgaaaaggccgtcgatccgcgc
cacatggcacttgtcaacaagatggtcgacgaactcgaccggcgcggccgcaagaacggc
aagggcttctacgaatacccggcgaaaccggcgaagaagtatctgtggccggagctgaag
acgctctatccgcagaaggcggccgacaagatcgacgtcgaggtggtgaagcagcgcttc
ctcgcgacgatcgcgctcgaagcggcccgcactatcgaggaaggcatcgtcaccgacccg
cgcgaggcggatgtcggctcgatcctcggcttcggcttcgctccctacaccggcggcacg
ctctcctatatcgacggcatgggcaccaaggctttcgtcgcgatgtgcaacaagctagcc
aaggcttatggcgaccacttcaagccgacgccgcttctgaaggagatggcagagaagggc
gagaccttctacggtcggttcgacccctacggggaggcgccgaaggcggcttag

DBGET integrated database retrieval system