KEGG   Sinorhizobium fredii HH103: SFHH103_00229Help
Entry
SFHH103_00229     CDS       T01731                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SFHH103_00229 (pncA)
Enzymes [BR:sfh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SFHH103_00229 (pncA)
    3.5.1.-  
     SFHH103_00229 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256493..257092
Genome map
AA seq 199 aa AA seqDB search
MAEDALIVIDMQNDFCPGGALAVAGGDEIVPIVNRLIEGARHVILTQDWHPAGHSSFASS
HPGKAPFQTVTMPYGEQTLWLDHCVQGSPGADFHPALRWTTAELVIRKGFRTGIDSYSAF
FENDHRTPTGLAGYLRERGISKVSLCGLATDFCVAFSALDAVAEGFSTSVVLGACRGIDL
NGSLAAMTRRMRDAGVELI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatgccctgatcgtcatcgacatgcagaacgacttctgcccgggcggcgcg
cttgcggtggcgggcggcgatgaaatcgtgccgatcgtcaaccgcctgatcgaaggggcc
cggcacgtcatcctgacgcaggactggcacccggccgggcattcgagctttgcgtcgagc
caccccggcaaggcgcccttccagacggtaacgatgccctatggcgagcagacgctgtgg
ctcgatcactgcgtccagggaagtccgggcgccgattttcatcctgctctgcgatggacg
actgcggaactggtcatccgcaaggggttccgcaccgggatcgacagctattccgccttc
ttcgagaacgatcaccggaccccgaccggcctcgccggctacctgcgcgaacgcggaata
tccaaagtgtcgctctgcggcctggcgaccgatttctgcgtcgccttctcggcgctcgat
gcggtcgctgagggtttttcgacttccgtcgtgcttggcgcctgtcgcggcatcgatctg
aacggatcgcttgccgcgatgacccggcgcatgcgtgatgcgggcgttgaactgatctag

DBGET integrated database retrieval system