KEGG   Sinorhizobium fredii HH103: SFHH103_00522Help
Entry
SFHH103_00522     CDS       T01731                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00900  Terpenoid backbone biosynthesis
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SFHH103_00522 (ispE)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SFHH103_00522 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Phage_attach
Motif
Other DBs
NCBI-ProteinID: CCE95022
UniProt: G9A1T2
Position
complement(585201..586169)
Genome map
AA seq 322 aa AA seqDB search
MPRRRCRRSPPRRTRNLDSMQADGIAGFALTLAAPAKINLALHVVGQRADGHHLLESLVT
FAECGDRIAFAPADADNFTVSGPFSRDVPVSAEGKSGNLVLRARDLLRRELIDRGDAAGP
VHLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAEVAPERLASLALELGADVPMCLDGR
PLLARGIGEEITPLADLPSFAIVLVNPLVAVSTPIIFRMLAEKRNPPLTLPQDARTATDW
VNALAGMRNDLEGPAKALEPTIEAVSNALQAVHADLVRMSGSGATCFGLFDSDENAAAAA
QRISADYPGWYVLATRTAGKRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggagacgctgccgaagaagcccgccgcgccggacaagaaatcttgatagcatg
caggccgatggcatcgccggcttcgcgctgacccttgcggcgccggccaagatcaacctg
gcactgcatgtcgtcggtcagcgcgccgacgggcatcatcttctggaaagcctcgtcacc
tttgcagagtgcggcgacaggatcgcattcgcgccggcggatgccgacaacttcaccgta
tccggccctttttcgcgcgacgtgccggtttcggcggaaggcaaaagcggcaatctggtg
ctgcgggcgcgcgacctgctgcggcgggaattgattgatcggggcgatgctgcgggccct
gtccatctgcatctggagaagaacctgccgatcgcatccgggatcggcggaggctcggcg
gacgcggccgcgacgctgcgaggcctgctttcgctctggaaagccgaggtcgcgccggaa
aggctcgccagcctcgcgctggaacttggcgccgatgtgccgatgtgtctcgacggcagg
ccgctgcttgccagggggatcggcgaagagatcaccccgcttgccgatctgccgtccttt
gcgatcgtgcttgtcaatccgctcgtcgccgtctcgacgcccatcatctttcggatgctc
gccgagaagcgcaatcctcccctaacccttccgcaagacgcccgtaccgcgacggactgg
gtgaatgcactggccgggatgcggaacgatctggaggggccggcgaaagcgctggagccg
acgatcgaggcggtatcgaacgcgctgcaagcggtgcatgccgatctcgtacggatgtcc
ggctcgggcgccacatgtttcggtctgttcgacagcgacgaaaacgcggctgcggccgcg
caacgcatttccgccgattatccggggtggtacgttctagccacccgaaccgcggggaag
cgaggataa

DBGET integrated database retrieval system