KEGG   Sinorhizobium fredii HH103: SFHH103_00598Help
Entry
SFHH103_00598     CDS       T01731                                 

Gene name
thrC
Definition
protein ThrC
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SFHH103_00598 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SFHH103_00598 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SFHH103_00598 (thrC)
Enzymes [BR:sfh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SFHH103_00598 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(668294..669691)
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRALRGKSYQEIAFTVLQ
PFTNGEIPAAKFREMIDEAYATFRHPAIAPLVQTGPNAFVMELFHGSTLAFKDVAMQLLA
RLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPHGKVSPVQQRQMTTA
NASNVHAIAVNGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSINWARIMAQIVYYFTTAIA
LGGPDRRISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKTGRYEMREV
KATTSPSMDIQISSNFERLLFEAFGREASEVRAAMASLKQSGSFAIDEGALKKIRKEFRA
GRASEKQVAATIRETFKKSGYLLDPHTAIGVCVAARHEKPSAPMVVLGTAHPAKFPDAVK
SASGIDPTLPTWLADLMTRAERFDILDAELKNVETFIGERTRVRE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatttcgacgcgcggggaagcagcgcccctcggtttctgcgacgctcttctg
gcagggcttgcccgggacggcggcctctatctcccgaaggaatggccgaccttctcgaag
aaggaaatccgggccttgcgcggcaaatcctatcaggaaatcgccttcacggttctccag
cccttcacgaatggtgaaatcccggcggcgaagttccgcgagatgatcgacgaggcctac
gccactttccgccatccggccattgcaccgctcgtccagaccggccccaacgcattcgtc
atggagctcttccacggttcgacgctggccttcaaggacgtcgcgatgcaattgctcgcc
cgcttgatggaccatgttcttgccgaacgcggcgaacgggcgacgatcgtcggggcgacc
tccggcgatacggggggtgctgcgatcgacgcctttgccggtcgggatcggaccgacatc
ttcattctcttcccgcatggaaaggtctcgccggtccagcagaggcagatgacgaccgcc
aatgcatcgaacgtgcatgcgatcgccgtcaacggcaatttcgacgattgccagaatctg
gtgaaagccatgttcaacgacacggcctttcgcgatcgcgtcaagctgtcgggcgtcaac
tcgatcaactgggcgcgcatcatggcgcagatcgtctactatttcacgacggccattgcc
ctcggcggcccggaccggaggatctccttcaccgtgccgaccggcaatttcggcgacatc
ttcgccggctatgtggccaagcgcatgggcctgccgatcgacaaactcatcatcgcgacc
aacgagaacgacattctggcgcgcacgctgaagaccggccgctacgagatgcgggaggtg
aaggcgacgacctcgccgtcgatggacatccagatctcgtccaacttcgagaggctgctg
ttcgaggcctttgggcgcgaggcgtcagaagtgcgcgccgccatggcaagcctcaagcaa
tccggttcctttgcgatcgacgagggcgcactgaaaaaaattcgcaaggaatttcgcgct
gggcgcgcgtcggaaaagcaggtggccgcaacgatccgcgagactttcaagaaatcgggc
tatctccttgatccgcatacggcaatcggcgtctgcgtcgccgccaggcacgagaagccg
tcggcaccgatggtggttctcggcaccgcccaccccgcgaaatttcccgacgcggtaaaa
tcggccagtggtattgaccccacgcttccgacgtggcttgctgatctgatgactagggcg
gagcgtttcgatattctggatgctgagctgaaaaacgtcgaaaccttcatcggcgagcgt
acccgcgttcgggaatag

DBGET integrated database retrieval system