KEGG   Sinorhizobium fredii HH103: SFHH103_00629Help
Entry
SFHH103_00629     CDS       T01731                                 

Gene name
adha3
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SFHH103_00629 (adha3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_00629 (adha3)
  Lipid metabolism
   00071 Fatty acid degradation
    SFHH103_00629 (adha3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SFHH103_00629 (adha3)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SFHH103_00629 (adha3)
   00626 Naphthalene degradation
    SFHH103_00629 (adha3)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SFHH103_00629 (adha3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(706025..707047)
Genome map
AA seq 340 aa AA seqDB search
MAQTMKAAVVRAFRAPLVIEELEAPSPSPGQIVVKYEATGVCHTDLHAASGDWPVKPTPP
FIPGHEGVGFVSAVGAGVRRVKEGDRVGVPWLHSACGYCPYCRTGWETLCASQSNTGYSV
NGTFAQFGLADPDFVGRLPDGLDFGPAAPVLCAGVTVYKGLKETEVRPGEWVAVSGVGGL
GHMAVQYAKAMGMHVVAADVFEDKLALARQLGADITVNGKDKDAIDQVQKAVGGVHGALV
TAVSPAAMEQAFGFLRSKGTMALVGLPPGKIALPVFETVLKRITVRGSIVGTRQDLEESL
QFAAEGKVVPHFSWDELENINAIFHRMEEGQIEGRIVLRL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcacagactatgaaggcggcggtcgtccgagcctttcgggctccgctcgtcatagag
gagctggaggcgccaagtcccagccctggacagatcgtcgtaaaatacgaagccaccggc
gtctgtcacacggaccttcatgcggcgagcggcgactggccggtgaagcccacgccgccc
ttcatccccggacacgagggggtcggcttcgtctccgcggtgggagccggtgtcaggagg
gtaaaggagggcgatcgcgttggcgtaccctggctgcattccgcctgcggctactgcccc
tactgtcgaaccgggtgggaaacgctgtgtgcatcgcagtcgaacaccggatactccgta
aacggcaccttcgcccaattcggccttgccgatcccgacttcgtcggccgcctgccggac
ggccttgattttgggccggcagctccggtgctttgcgccggcgtgactgtctacaagggt
ctgaaggaaaccgaggttcgccctggggagtgggtggcggtatccggcgtcggcggtctg
ggtcacatggcggtccaatacgccaaggcgatgggcatgcatgtcgtcgccgcagacgta
ttcgaggacaagctggccttggccaggcagcttggggcggacatcaccgtcaacggcaag
gacaaggacgcgatcgaccaggttcaaaaggcggttggcggggtccatggcgcacttgtc
acggcagtttcacccgcggcaatggagcaggccttcgggttcctgcggtcgaagggcacc
atggcgctcgtcggccttccgcccggaaagattgcgctgcctgttttcgaaactgtgttg
aagcgtatcacggtgcgcgggtcgatcgtcggaacacgccaggaccttgaggaatcgctg
cagtttgccgcagagggcaaggtcgtgccgcacttctcctgggacgagctggaaaacatc
aatgcgatcttccaccgcatggaagaaggacagatcgagggccggatcgttctgaggctg
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system