KEGG   Sinorhizobium fredii HH103: SFHH103_01026Help
Entry
SFHH103_01026     CDS       T01731                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sfh00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sfh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1116069..1117010)
Genome map
AA seq 313 aa AA seqDB search
MITFPHRHLLGIKGLTEQDITLLLDRADEAVKISRQREKKTSSLRGLTQINLFFEASTRT
QSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMHPDVLVVRHASAGAAALLA
QKVSCSVVNAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
QMGARVRVVAPATLLPAGIEQMGAEVYRSMAEGLKDADVVMMLRLQRERMAGSFVPSVRE
YFHYYGLDAEKLKAAKDDALVMHPGPMNRGVEIASEIADGPQSVIEQQVEMGVAVRMAVM
ETLLLSQDQGPRP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttcccgcatcgccacctgcttggcatcaaggggctgacggaacaggacatc
acgctcctgctcgatcgggccgacgaagccgtgaagatctcccggcagagggagaaaaag
acctcgtcgctgcgcggactgacgcagatcaacctcttcttcgaggcgtcgacccgcacg
caatcctccttcgaactggctggcaaacggctcggcgccgacgtcatgaacatgtcggtc
ggcaactcctcggtgaagaagggggagacgctgatcgacacggcgatgacgctgaatgcg
atgcacccggacgtgctcgtcgtgcgccacgcgtcggccggcgccgcggcactgctcgcg
cagaaggtctcctgctcggtcgtcaacgccggcgacggccagcacgagcatccgacgcag
gcactcctcgacgcgctgacgatccgccgcgccaagggcaagttgtcgcggatcatcgtg
gcgatctgcggcgacgtcctgcactcgcgtgtcgcccgctccaacattctgcttctcaac
cagatgggcgcccgcgtccgtgtcgtcgcgccggcgaccttgctccccgccggcatcgaa
cagatgggtgccgaggtctatcgctccatggcggagggcctgaaggatgccgacgtggtg
atgatgctgcgcctccagcgcgagcgcatggccggctccttcgtcccatcggtgcgcgag
tatttccactattacgggctcgacgcggaaaagctgaaagccgctaaggatgatgcgctc
gtcatgcatccaggaccgatgaaccgcggcgtcgagatcgcctcggagatcgccgacgga
ccgcaaagcgtcatcgaacagcaggtcgagatgggcgtcgcggtgcgcatggccgtcatg
gaaacacttcttctctcgcaggaccaggggccgcgcccatga

DBGET integrated database retrieval system