KEGG   Sinorhizobium fredii HH103: SFHH103_01161Help
Entry
SFHH103_01161     CDS       T01731                                 

Gene name
tpiA
Definition
(GenBank) tpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00010  Glycolysis / Gluconeogenesis
sfh00051  Fructose and mannose metabolism
sfh00562  Inositol phosphate metabolism
sfh00710  Carbon fixation in photosynthetic organisms
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
sfh01230  Biosynthesis of amino acids
Module
sfh_M00002  Glycolysis, core module involving three-carbon compounds
sfh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_01161 (tpiA)
   00051 Fructose and mannose metabolism
    SFHH103_01161 (tpiA)
   00562 Inositol phosphate metabolism
    SFHH103_01161 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SFHH103_01161 (tpiA)
Enzymes [BR:sfh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SFHH103_01161 (tpiA)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SFHH103_01161 (tpiA)
  Exosomal proteins of bladder cancer cells
   SFHH103_01161 (tpiA)
  Exosomal proteins of melanoma cells
   SFHH103_01161 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCE95659
UniProt: G9A515
Position
1242908..1243678
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGALSAKVETLICPPATLLYVATALCDD
SPLMIGAQNCHQKQSGAHTGEISAEMIADCFGTHVIVGHSERRTDHAETDALVRAKTEAA
HAADLVAIVCIGETEEERRSGKTLDVLKRQLAESLPDGATAESTVIAYEPVWAIGTGLTP
TVGDVEEAHAFMRRELVARFGAEGGKMRILYGGSVKPSNARELMGVANVDGALIGGASLK
AEDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctggttgccggcaactggaagatgaatggcacgcgtgca
tcgctggaccagatcaaggcgatggccgagggcgtcaagggcgcactttccgccaaggtg
gagacgctgatctgcccgccggcgacgctgctctatgttgcaaccgcactttgcgacgac
agtccgctgatgatcggcgcccagaactgccaccagaagcagtcgggcgcccacaccggc
gagatttccgccgagatgatcgccgattgcttcggcactcatgtcatcgtcggccactcc
gaacgccgcaccgatcacgccgagactgatgcgctggtcagggcgaagacggaagccgcg
cacgccgccgacctcgtcgccatcgtttgcatcggcgagaccgaagaagaacgcaggagt
ggcaagacgcttgacgtcctgaagcgccagctcgccgaaagcctgccggatggcgcgacg
gctgagagcaccgtgatcgcctacgagccggtctgggcgatcggcaccggcctgacgccg
accgttggagatgtggaggaggcgcatgccttcatgcgcagggagcttgtcgcccgcttc
ggtgcggaaggcggcaagatgcggatcctgtacggcggctccgtcaagccgtcgaatgcc
agggaactgatgggcgtcgccaatgtggacggtgcgctgatcggcggcgccagcttgaaa
gcggaagacttcctcgccatctaccgggcctatgaagaattgactgcgtga

DBGET integrated database retrieval system