KEGG   Sinorhizobium fredii HH103: SFHH103_01161Help
Entry
SFHH103_01161     CDS       T01731                                 

Gene name
tpiA
Definition
protein TpiA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_01161 (tpiA)
   01230 Biosynthesis of amino acids
    SFHH103_01161 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_01161 (tpiA)
   00051 Fructose and mannose metabolism
    SFHH103_01161 (tpiA)
   00562 Inositol phosphate metabolism
    SFHH103_01161 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SFHH103_01161 (tpiA)
Enzymes [BR:sfh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SFHH103_01161 (tpiA)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SFHH103_01161 (tpiA)
  Exosomal proteins of bladder cancer cells
   SFHH103_01161 (tpiA)
  Exosomal proteins of melanoma cells
   SFHH103_01161 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242908..1243678
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGALSAKVETLICPPATLLYVATALCDD
SPLMIGAQNCHQKQSGAHTGEISAEMIADCFGTHVIVGHSERRTDHAETDALVRAKTEAA
HAADLVAIVCIGETEEERRSGKTLDVLKRQLAESLPDGATAESTVIAYEPVWAIGTGLTP
TVGDVEEAHAFMRRELVARFGAEGGKMRILYGGSVKPSNARELMGVANVDGALIGGASLK
AEDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctggttgccggcaactggaagatgaatggcacgcgtgca
tcgctggaccagatcaaggcgatggccgagggcgtcaagggcgcactttccgccaaggtg
gagacgctgatctgcccgccggcgacgctgctctatgttgcaaccgcactttgcgacgac
agtccgctgatgatcggcgcccagaactgccaccagaagcagtcgggcgcccacaccggc
gagatttccgccgagatgatcgccgattgcttcggcactcatgtcatcgtcggccactcc
gaacgccgcaccgatcacgccgagactgatgcgctggtcagggcgaagacggaagccgcg
cacgccgccgacctcgtcgccatcgtttgcatcggcgagaccgaagaagaacgcaggagt
ggcaagacgcttgacgtcctgaagcgccagctcgccgaaagcctgccggatggcgcgacg
gctgagagcaccgtgatcgcctacgagccggtctgggcgatcggcaccggcctgacgccg
accgttggagatgtggaggaggcgcatgccttcatgcgcagggagcttgtcgcccgcttc
ggtgcggaaggcggcaagatgcggatcctgtacggcggctccgtcaagccgtcgaatgcc
agggaactgatgggcgtcgccaatgtggacggtgcgctgatcggcggcgccagcttgaaa
gcggaagacttcctcgccatctaccgggcctatgaagaattgactgcgtga

DBGET integrated database retrieval system