KEGG   Sinorhizobium fredii HH103: SFHH103_01170Help
Entry
SFHH103_01170     CDS       T01731                                 

Definition
pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_01170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_01170
   00020 Citrate cycle (TCA cycle)
    SFHH103_01170
   00620 Pyruvate metabolism
    SFHH103_01170
Enzymes [BR:sfh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SFHH103_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1252426..1253754
Genome map
AA seq 442 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAADGEDVATAAKGGNGAAAPASAAKAEAAAPAAPAASPAPAAA
PAAPAQAAGEGKRVFSSPLARRLAKEAGIDLSAIAGSGPYGRVVKKDVESAVSGGTAKPA
AAPAAAQAPAAAPLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLQESKQTIPHFYV
SLDCQLDALLALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSWTDTNM
VKHKHADVGVAVSIPGGLITPIIRQAELKSLSAISNEMKDYGKRAKERKLKPEEYQGGTT
AVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVIVKNKEMVVANMMTVTLSTDHRCVDG
ALGAELLGAFKRYIENPMGMLV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcacaatgcctgccctctcgccgaccatggaagaaggcaatctcgcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgacgtcatcgccgagatcgaa
actgacaaggcgacgatggaagtcgaagccgtcgatgagggcaccgtcgccaagatcgtc
gttccggccggcaccgaaggcgtcaaggtcaatgccttgatcgcggttctggccgcggac
ggcgaggacgtcgcaaccgcggccaagggcggcaatggcgctgccgcgccggcgtccgcc
gccaaggcggaagcagctgctcctgcagcgcccgccgcgtcacctgcaccggccgcagcc
cccgctgctccggcacaggctgcgggtgagggcaaacgcgtcttctcctcgcccctggcc
cgtcgtcttgccaaggaagcgggcatcgacctctccgcaattgccggttccggcccttac
ggccgcgtcgtcaagaaggatgtggaatctgcggtctccggcggcacggccaaaccggcc
gcagcaccggctgccgctcaggcaccggccgcggcaccgctcgccaagggcatgtccgag
gatgccgtcctgaagctcttcgagccgggctcctacgagctcgtcccgcatgacggcatg
cgcaagacgattgccaagcgcctgcaggaatcgaagcagacgatcccgcacttctacgtc
tctctcgattgccagctcgatgcgctgctggcgctgcgtgcccagctcaatgcggctgcc
cccgaaaaggacggcaagccggtttacaagctctcggtcaatgacatggtgatcaaggcg
ctggcgctggcgctgcgtgacgttccggatgcgaacgtctcctggaccgacacgaacatg
gtcaagcacaagcacgccgatgtcggcgttgctgtgtcgatcccgggcgggctgatcacg
ccgatcatccgccaggcggagttgaagagcctttcggccatctccaacgagatgaaggac
tacggcaagcgcgccaaggagcgcaagctgaagcccgaggaataccagggcggtaccacg
gcggtttccaatatggggatgatgggcgtcaagaacttcgcggccgtcgtcaacccgccg
catgcgacgatcctcgcggtcggtgccggcgaggaacgggtcatcgtcaagaacaaggag
atggtcgtcgccaacatgatgaccgtcacgctctcgaccgaccatcgctgcgtcgatggt
gcgctcggcgccgaactgctcggggccttcaagcgctacatcgaaaacccgatgggcatg
ctcgtctga

DBGET integrated database retrieval system