KEGG   Sinorhizobium fredii HH103: SFHH103_01235Help
Entry
SFHH103_01235     CDS       T01731                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfh  Sinorhizobium fredii HH103
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319022..1319681
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLTAFLSVPREEFVPAKMKELAYIDTDIELVGGAAP
RHLMEPSPLAKLLQLARISKSDKVLEIGSGTGYASALLSLIAGSVVALESDEKLFAAATE
TLARLGYGNVAVTSGPLTNGYAAEAPYDVIFINGAVEAIPAPLFEQLRDGGRLIAVEGFG
NASRAKLYMRESGRTSERSDFNTSVKPLPGFHRERPFIF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcgcgcattaagatggtggacaaccagatccgaacgacggatgtg
acctcccattcggttctgactgccttcctctccgtgccacgcgaggaattcgtgccggcg
aagatgaaggaacttgcctatatcgacaccgatatcgagcttgtcggcggggccgccccg
cgccacctcatggagccgtcgccactggcgaaattgctgcaactcgcccgaatcagcaaa
tcggacaaggtcctcgagatcggttcggggacgggttacgcttccgctttgctgtcgctg
atagccggctctgtggtggcgctggaaagcgatgagaagcttttcgccgcagcaaccgaa
acgctggcgcgtctcggctatggcaacgttgcggtgacaagcggccctctcaccaacgga
tatgcagccgaagcgccctatgacgtgatcttcatcaacggtgcggtcgaagctatccca
gccccgctcttcgagcagcttcgggacggcggtcgccttatcgccgttgaagggtttggt
aacgcctcacgtgcaaaactctatatgcgcgaatcgggcagaacttccgagcgatccgat
ttcaacacgtccgtgaagccgctgcctggcttccatcgcgagcggccgtttattttctga

DBGET integrated database retrieval system