KEGG   Sinorhizobium fredii HH103: SFHH103_01247Help
Entry
SFHH103_01247     CDS       T01731                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sfh00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sfh00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337737..1338816
Genome map
AA seq 359 aa AA seqDB search
MERPGVGLRLRGLTAGHYDPVMNESKAFISGCKGLSLTVEERSFFAGERPWGFILFGRNI
GEKEQICDLVAALRDSVDNPKAPVLIDQEGGRVQRIRPPLVQQYPSGAAIGEIYRRDDQM
GLRAAWLLGRLHAFDLMRFGITVDCLPVLDVPVPGSHDVIGNRAYGHDPVTVTAIGRAVS
EGLKAGGMLPVMKHMPGHGRTFVDSHHNLPVVDASLEELKRVDFQPFAAMKDEAMAMSAH
MVFTEIDPDNPATTSPRVVREIIRDYIGFDGLLMSDDVSMNALAGDMTTRARAIIGAGLD
LVLHCHGIMEEMKAVADVVPVLSGDRFRRARAAEAAFRQPDGSNEDTLRAEFNAMFALA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggagaggccgggcgttggtttgcggcttcgcggtttgaccgcaggacactatgatcca
gtcatgaacgaatcaaaggcattcatctcgggctgcaaaggcctttccctgacggtggaa
gagcgcagcttcttcgccggcgaacgcccctggggcttcattctcttcggccgcaacatc
ggtgagaaagagcagatctgcgatctcgtcgcggccttgcgggacagcgtcgataatccg
aaagcaccggtcctgatcgatcaggagggcggccgtgtccagcgcattcgcccgccgctc
gtgcaacaatatccgagcggtgcggcgatcggcgagatttaccgtcgcgacgatcagatg
gggttgcgcgccgcttggctgcttgggcgcctccatgcgtttgatctcatgcgcttcggc
atcacggtggattgcctgccggtgctcgacgtgccggtgcccggcagccatgacgtcatc
ggcaaccgtgcctatggacacgatccggtgaccgtgacggcgatcggccgcgcggtgagc
gagggcctgaaagcaggcggcatgctgccggtgatgaagcacatgccgggccacggccgc
actttcgtcgattcgcatcacaatctgccggtggtcgacgcctcgctggaggaactgaag
cgcgtcgacttccagcctttcgccgccatgaaggacgaggcgatggccatgtcggcgcat
atggtcttcacggaaatcgacccggacaatccggcgacgacatctccaagggtcgtgcgg
gaaatcatccgcgactatatcggcttcgacggcttgttgatgtccgacgatgtttccatg
aacgcccttgcaggggatatgaccacccgcgcccgtgcgattatcggggcagggctcgat
ctcgtcttgcattgtcatggcattatggaagaaatgaaggccgtcgccgatgtggtgccg
gttctttcgggcgatcggttccggcgagccagggcggccgaggcggccttccggcagccg
gatggttcgaatgaagacacattgcgagcggagttcaatgcgatgttcgcgctcgcctag

DBGET integrated database retrieval system