KEGG   Sinorhizobium fredii HH103: SFHH103_01325Help
Entry
SFHH103_01325     CDS       T01731                                 

Gene name
pcm3
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfh  Sinorhizobium fredii HH103
Brite
Enzymes [BR:sfh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SFHH103_01325 (pcm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1429851..1430522)
Genome map
AA seq 223 aa AA seqDB search
MKPMNEEHLAILRRHMVEVIAIYADLASEELGKAALDERVMAAMLRVPRHLFVPAQAAPF
AYQDTPLPIGFDKTVSQPFMVALMTDLLAPQPHEAVLEIGTGLGYQTAILAELAGQVWSV
EIIEEFASHAEVLLQRLGLSNVGIRVGDGSRGWPERAPFDKILVTAAAEEPPPALLEQLK
PMGRMVLPVGTEEQLLTVIDKDSAGQFETRKLIPVRFSRLEAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgaacgaagagcacctggcgattctgcgcaggcacatggtcgaggtgatt
gcaatctatgccgaccttgccagcgaagaactgggcaaggcggcactcgatgagcgggtg
atggctgcgatgctgcgggtgccccggcatctctttgtgcccgcccaggctgcgcccttt
gcctaccaggatacgcccctgccgatcggcttcgataaaaccgtgtcgcagcccttcatg
gtcgctctgatgaccgatctccttgctccccaaccgcatgaagccgtgctcgagatcggc
accggcctcggctaccaaaccgcaatcctcgcggaactcgccggacaagtttggagcgtc
gaaatcatcgaggaattcgccagccatgccgaggtcctgctacagcgcctcggcctatca
aatgtcggcattcgtgtcggcgacgggtctcgtggctggcctgagcgcgccccattcgac
aagatcctggtcacggcggcggctgaggagcctccgcccgccttgctcgagcagctcaag
ccaatgggccgcatggttcttcctgtgggcactgaagaacagttgctgactgtcatcgac
aaggattcggcaggacagttcgagacgcggaaactcatcccggttcggttcagccggctc
gaggcggcctga

DBGET integrated database retrieval system