KEGG   Sinorhizobium fredii HH103: SFHH103_01334Help
Entry
SFHH103_01334     CDS       T01731                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_01334
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SFHH103_01334
Enzymes [BR:sfh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SFHH103_01334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1436322..1438070)
Genome map
AA seq 582 aa AA seqDB search
MGRDIFRAFPCLITTLQNWLVKFDNSTLQALQSPRKSAYAFAYATLTSSEEIMSYEAYLD
EASRLIKDNGNWSGITAESVARMRLQNRFRTGLDIARYTASIMRRDMAAYDKDPGKYTQS
LGCWHGFIAQQKVISLKKHFGSTERRYLYLSGWMVAALRSEFGPLPDQSMHEKTSVPALV
EELYTFLRQADARELATLFREIDKARSAGDTVREQQLTQAVNNHQTHVIPIIADIDAGFG
NAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHEEFVAKIRACRYAFLEL
GVDDGIIVARTDSLGAGLTKQIAFSASEGDIGDQYNSFLDCEDVTDQKPSNGDVLITRGS
RVLRPKRLRSNLYQFREGTGVDRCVLDCINAIRNGADLLWIETEKPHVEQIAGMMDRIRD
VIPDAKLVYNNSPSFNWTLNFRQQIFDAWQRDGKDVSGFDRARLMSEEYDGSELAREADE
RIRTFQRDASKRAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVANVQRKEIRQG
IACVKHQNMAGSDIGDDHKDYFAGEAALKAGGEHNTMNQFAA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgagatatattccgagcttttccatgcctcattacaacattacaaaattggctt
gtaaagtttgacaactcgacactgcaagcgcttcagagtccaaggaagagcgcctatgcc
ttcgcctacgcaacactgacatcctcggaggaaatcatgtcctatgaagcttacctcgat
gaagcatcccgcctgatcaaggacaacggcaactggagcggcataaccgccgaatcggtt
gcccgcatgcgtctgcagaaccgcttcaggaccggattggacatcgcgcgctacacggct
tccatcatgcgccgggacatggccgcctatgacaaggatccgggcaagtacacccagtcg
ctcggttgctggcacggcttcatcgcacagcagaaggtcatctccctgaagaagcacttc
ggctcgacggaacggcggtacctctacctttccggttggatggttgcggcgcttcgctcc
gagttcggtccgcttccggaccaatccatgcatgagaagaccagcgttccggcgctggtc
gaggagctttacactttccttcgccaggccgatgcgcgcgagctcgccacattgttccgg
gagatcgacaaggcccgctcggccggtgacacggtgcgcgaacagcaactcacccaagcg
gtcaacaatcaccagacgcacgtcatcccgatcatcgccgacatcgatgcgggcttcggc
aacgcagaggcgacgtatctgctcgccaagaagatgatcgaagccggcgcctgcgcgctc
cagatcgagaaccaggtttccgacgaaaaacaatgcggccatcaggacggcaaggtaacc
gttcctcacgaggagttcgtcgccaagatccgggcatgccgttacgcgtttctcgaactc
ggcgtcgacgacggcatcatcgtcgcgcgaaccgactcgctcggtgcgggtctaacgaaa
cagatcgccttcagtgccagcgaaggtgacatcggcgaccaatacaactcgttcctggat
tgcgaggacgtcacggatcaaaagccgtccaatggagacgtcttgatcaccagagggtcg
agggtcctgcggcccaagcggctgaggtcaaatctctaccagttccgggaaggcacgggt
gtcgaccgctgcgtcctggattgcatcaacgcaatcaggaacggcgccgaccttctctgg
atcgagacggagaagccgcatgtcgagcagatcgccggaatgatggaccgtatccgcgac
gtcatcccggatgcgaagctcgtctacaacaactctccatcgttcaactggacgctgaac
ttccgccagcagatcttcgacgcctggcagagggacggcaaggacgtctccggcttcgac
agggcgaggctgatgagcgaggagtacgacggcagtgaactggcgcgcgaggctgacgag
cgcatccgcaccttccagcgcgacgcctcgaagcgggccggcatcttccatcacctcatc
accttgccgacctaccacaccgccgcgctttccaccgacaatctcgccaaggagtacttc
ggtgaccagggcatgctcggctacgtcgccaacgtgcagcgcaaggagatccgacagggc
atcgcctgcgtgaagcaccagaacatggccggctccgacatcggtgacgaccacaaggat
tatttcgccggcgaagccgccctcaaggctggtggcgagcacaacaccatgaaccagttc
gccgcctga

DBGET integrated database retrieval system