KEGG   Sinorhizobium fredii HH103: SFHH103_01544Help
Entry
SFHH103_01544     CDS       T01731                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1666676..1667248)
Genome map
AA seq 190 aa AA seqDB search
MLRSLGFWTTWKSRSSMSSGKTWRRATLGLGGNIGDPRRAMADALRALDAQPDCRVTAVS
RLYRTPPWGKTDQNWFFNACAAVETTRDPEALLATCLEIERTLKRIRTERWGPRTIDIDL
LTFDGVILVNDRLQLPHPRMTERGFVLMPLADIAAGLEVAGKTVGEWLVDADVAGIEVAD
ETADWWRGRD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgctccggtccctggggttctggactacgtggaagtcacggtcgagcatgtcgtcgggt
aagacgtggcggcgcgccaccctggggctgggtggcaatatcggcgatccgcgccgcgcc
atggcggatgccctgcgggcgcttgacgcgcagccggattgccgagtcacggcagtttcg
cggctctaccggacgccgccctggggcaagacggaccagaactggttcttcaatgcctgc
gcagcggtcgaaaccacccgcgatcccgaagcgctgcttgcaacctgcctcgagatcgag
cggacattgaagcgcatccgcacggagcgctgggggccgcgcacgatcgacatcgatctc
ctgaccttcgacggagtgatcttggtcaacgacaggctgcaattgccgcatccgcgcatg
accgagcgcgggttcgtgctgatgccgcttgccgatattgcggctggcctcgaagtcgcg
ggcaaaactgtcggcgagtggttggtggacgcagacgtggctggaatcgaagtggccgac
gagacggccgactggtggcggggccgcgattga

DBGET integrated database retrieval system