KEGG   Sinorhizobium fredii HH103: SFHH103_01587Help
Entry
SFHH103_01587     CDS       T01731                                 

Definition
(GenBank) Uncharacterized membrane protein in llm 5'region ORF1
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sfh  Sinorhizobium fredii HH103
Brite
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SFHH103_01587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1720859..1721929
Genome map
AA seq 356 aa AA seqDB search
MQTATSNKTPTPDIAAQITHAMRMMGVAPIPRNYELYYEAYLGSNPQLSKELAALGSRAT
QEDLDVIGARYFSHIHHSRGIERAHSTLAEKLTELVALLRDEQYALESYNRVLDEAYLNI
ANKSASSADILRHAIDILSEATADTMNQGKERVQTVVQKSVEMEAIRQELDEYKRIANTD
SLTRLSNRRAFDETLAAVYNNEQLRNYTGLLVVDIDHFKKVNDSFGHPVGDKILSTVGTV
IRANLRRDAFVARTGGEEFAVILSDSTQEECMQAADRIRTVLANTPFKNSKTGVNYGPIT
LSVGVCMATAADDPLDLYHKADIALYAAKNSGRNRTVLFEEGMRKDSGRNWLIYRR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggcaacttcgaacaagacgccgacgcccgatatcgctgcgcagattacccat
gcaatgcgtatgatgggcgttgcgccgataccgcgcaattacgagctttactacgaggcc
tatctgggctccaacccgcaactgtcaaaggaactcgcggcacttggaagccgcgcgacg
caggaagatctcgacgtcatcggtgcgcgctatttcagccatatccaccattcgcgtggg
atcgagcgcgcccacagcacgctggcggaaaagctgaccgagctggttgccctgctgcgg
gacgaacaatacgcactcgagagctacaacagggttctcgacgaagcctacctgaacatt
gccaacaagagcgcatcgagcgccgacatcctccgccacgcgatcgacattctgagcgaa
gcgaccgccgacacgatgaaccagggtaaggagcgcgtacaaacggtcgttcagaaatca
gtcgagatggaagcgatccgccaggagctcgacgaatacaagcgtattgccaacaccgat
tcactgacgcggctcagcaatcggcgcgccttcgacgagactctcgccgcggtctacaac
aacgagcaattgcgcaactacacgggcctgctcgtcgttgacatcgaccacttcaagaag
gtcaatgacagcttcggccatccggtcggcgacaagattctctccaccgtcggcaccgtc
attcgtgcaaatctccggcgggacgccttcgtcgcccgcaccggcggcgaggagtttgcg
gtcatcctcagcgacagcacgcaggaggaatgtatgcaggcggccgaccgcatccgcacc
gtgctggcaaacacgcctttcaagaactccaagacaggcgtcaattatggtccgatcacg
ctctccgtcggtgtgtgcatggcaacggcggcggacgatccgctcgatctctaccacaag
gccgacatagcgctttacgcggcgaaaaattcggggcgcaacaggacggtcctcttcgag
gagggcatgcgcaaggattccggacggaactggctgatctatcgccgctag

DBGET integrated database retrieval system