KEGG   Sinorhizobium fredii HH103: SFHH103_01587Help
Entry
SFHH103_01587     CDS       T01731                                 

Definition
membrane protein in llm 5'region ORF1
Orthology
K13590  
diguanylate cyclase
Organism
sfh  Sinorhizobium fredii HH103
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1720859..1721929
Genome map
AA seq 356 aa AA seqDB search
MQTATSNKTPTPDIAAQITHAMRMMGVAPIPRNYELYYEAYLGSNPQLSKELAALGSRAT
QEDLDVIGARYFSHIHHSRGIERAHSTLAEKLTELVALLRDEQYALESYNRVLDEAYLNI
ANKSASSADILRHAIDILSEATADTMNQGKERVQTVVQKSVEMEAIRQELDEYKRIANTD
SLTRLSNRRAFDETLAAVYNNEQLRNYTGLLVVDIDHFKKVNDSFGHPVGDKILSTVGTV
IRANLRRDAFVARTGGEEFAVILSDSTQEECMQAADRIRTVLANTPFKNSKTGVNYGPIT
LSVGVCMATAADDPLDLYHKADIALYAAKNSGRNRTVLFEEGMRKDSGRNWLIYRR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggcaacttcgaacaagacgccgacgcccgatatcgctgcgcagattacccat
gcaatgcgtatgatgggcgttgcgccgataccgcgcaattacgagctttactacgaggcc
tatctgggctccaacccgcaactgtcaaaggaactcgcggcacttggaagccgcgcgacg
caggaagatctcgacgtcatcggtgcgcgctatttcagccatatccaccattcgcgtggg
atcgagcgcgcccacagcacgctggcggaaaagctgaccgagctggttgccctgctgcgg
gacgaacaatacgcactcgagagctacaacagggttctcgacgaagcctacctgaacatt
gccaacaagagcgcatcgagcgccgacatcctccgccacgcgatcgacattctgagcgaa
gcgaccgccgacacgatgaaccagggtaaggagcgcgtacaaacggtcgttcagaaatca
gtcgagatggaagcgatccgccaggagctcgacgaatacaagcgtattgccaacaccgat
tcactgacgcggctcagcaatcggcgcgccttcgacgagactctcgccgcggtctacaac
aacgagcaattgcgcaactacacgggcctgctcgtcgttgacatcgaccacttcaagaag
gtcaatgacagcttcggccatccggtcggcgacaagattctctccaccgtcggcaccgtc
attcgtgcaaatctccggcgggacgccttcgtcgcccgcaccggcggcgaggagtttgcg
gtcatcctcagcgacagcacgcaggaggaatgtatgcaggcggccgaccgcatccgcacc
gtgctggcaaacacgcctttcaagaactccaagacaggcgtcaattatggtccgatcacg
ctctccgtcggtgtgtgcatggcaacggcggcggacgatccgctcgatctctaccacaag
gccgacatagcgctttacgcggcgaaaaattcggggcgcaacaggacggtcctcttcgag
gagggcatgcgcaaggattccggacggaactggctgatctatcgccgctag

DBGET integrated database retrieval system