KEGG   Sinorhizobium fredii HH103: SFHH103_02070Help
Entry
SFHH103_02070     CDS       T01731                                 

Definition
putative aldehyde dehydrogenase
Orthology
K00137  
aminobutyraldehyde dehydrogenase [EC:1.2.1.19]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Arginine and proline metabolism
beta-Alanine metabolism
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sfh00330]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sfh00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2222885..2224312
Genome map
AA seq 475 aa AA seqDB search
MDTQLLIGSRFEAGTEAEEHILNPRTGARIIDLAEASHAQIDAAVDAAERAFVTWSGTTP
AERSSHLLKIADAIEKHADDFAALEALNCGKPINAVKNDELPAIIDCWRFFAGAVRNLHG
PTAGEYLPGHTSMIRRDPIGIVGSIAPWNYPLMMMAWKLAPAIAGGNTVVFKPSEQTPLT
ALKLARLLADILPEGVVNVITGRGETVGNALINHPKVSMVSITGDIATGKKVLTAAAKTV
KRTHLELGGKAPVIVYDDADLEAVVNGIRTFGYYNAGQDCTAACRIYAEAGIYEKLVADL
TSAVSTIRYNLADDTENEIGPLISKRQRDRVASFVERAADQKHIEITTGGRTGSAEGFFF
QPTVVAGATQEDEIVRREVFGPVVSVTRFTGKDDVVAWANDSDYGLASSVWTKDISRAMK
AASRLQYGCTWINTHFMLTNEMPHGGVKQSGYGKDMSVYALEDYTTVRHIMINHG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggacacccaactcctgatcggatcgcgcttcgaggccggaaccgaggccgaggagcac
atcctgaacccgcggacgggcgccaggatcatcgacctcgccgaagcctcccatgcgcag
atcgacgccgccgtggacgcggcagagcgcgctttcgtcacctggtctgggacgacgccg
gccgagcgttcgagccatctcctgaaaatcgccgatgcgatcgagaaacacgccgacgac
tttgccgcgctcgaagccctgaactgcggcaagccgatcaatgcggtgaagaacgacgag
ctgccggcgatcatcgattgctggcgtttctttgccggcgcggtgcgcaacctgcatggg
ccgacggccggcgaatacctgccgggccacacctcgatgattcgccgcgacccgatcggc
atcgtcggctccatcgcgccctggaactatcccttgatgatgatggcctggaagctggca
ccggcgatcgccggcggcaacaccgtggtcttcaagccctcggagcagacgccgctgacc
gcgctgaagctggcgcggctcttggccgacattcttcccgagggcgtcgtcaacgtcatc
accggccgcggcgaaacggtcggcaatgcgttgatcaatcaccccaaggtgtcgatggtg
tcgatcaccggcgacatcgccaccggcaagaaggtgctcaccgccgcggcgaagacggtc
aagcggacccatctcgaactcggcggcaaggcgccggtcatcgtctatgacgacgccgat
ctcgaggcagtcgtcaacggcatccggaccttcggctattacaatgccggccaggactgc
accgccgcctgccgcatctatgccgaagccggcatctacgagaagctcgtcgccgacctc
acaagcgccgtttccacgatccgctacaaccttgcggacgacaccgagaatgagatcggg
ccgctgatctccaagcgccagcgcgatcgcgtcgcgagcttcgtcgagcgggcggcggac
cagaagcatatcgagatcaccaccggcggacgcacaggcagcgcggagggtttcttcttc
cagccgaccgtcgttgccggcgcgacgcaggaggacgagatcgtccggcgcgaagtcttc
gggccggtggtttccgtgacacgcttcaccggcaaggacgacgtcgtcgcctgggcgaat
gacagcgactatggcctcgcctcctccgtctggacgaaggatatcagcagggcgatgaag
gccgcctcacggctgcaatatggctgcacctggatcaacacccatttcatgctgaccaat
gaaatgccgcacggcggcgtcaagcagtccggctacggcaaggacatgtccgtctacgcg
ctcgaggattacaccaccgttcgccacatcatgatcaatcacggctag

DBGET integrated database retrieval system