KEGG   Sinorhizobium fredii HH103: SFHH103_02254Help
Entry
SFHH103_02254     CDS       T01731                                 

Gene name
glpK
Definition
protein GlpK
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2417550..2419091)
Genome map
AA seq 513 aa AA seqDB search
MPLEEGRRLLRAEEGHMGGYILAIDQGTTSTRAIVFDGKQQVAGVGQREFRQHFPKSGWV
EHDPEEIWETVLFTARQAIEKAGISTSEIAAIGITNQRETVVVWDRATGKPIHNAIVWQD
RRTASFCDKLKKQGLEKTFTKKTGLLLDPYFSGTKLNWLLTNVKGAQARAAKGELCFGTI
DTFLIWRLTGGKSFVTDATNASRTLIYNIVDNSWDDELTDILRIPRAMLPDVKDCAADFG
VTDASLFSAAIPILGVAGDQQAATIGQACFKPGMLKSTYGTGCFALLNTGKDIVRSKNRL
LTTIAYRLNGETTYALEGSIFVAGAAVQWLRDGLKVIKAAPDTGTLAESADPTQEVYLVP
AFTGLGAPHWDPDARGAIYGMTRNTGPAEFARAALESVCYQTRDLLDAMHRDWRSNGKDT
VLRVDGGMVASDWTMQRLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPTQEEFAKSW
ARDRRFEPKMDGTTRKGKLKGWRSAVKRTLMAA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
ttgccgctagaggaagggcggcggctgttgcgtgccgaggaggggcatatgggcggatat
attctcgcgatcgatcagggtacgacgtccacgcgggcgatcgttttcgacggcaagcag
caggtcgcgggcgtcggccagagagaattcaggcagcattttccgaaatccggctgggtg
gaacacgacccggaggagatctgggagacagttctcttcaccgctcgacaggcgatcgag
aaggccggcatttccacgagtgaaatcgctgcgatcggcatcaccaaccaacgcgagacg
gtggtggtgtgggatcgcgcgacgggcaaaccgatccacaacgcgatcgtctggcaggac
cgccgcaccgcttccttctgcgataagctgaagaagcagggcctcgaaaagaccttcacc
aagaaaaccgggctgctgctcgatccgtatttctccggcacgaagctcaactggctgctc
accaatgtgaagggcgcgcaggcgcgcgccgccaagggcgaactctgcttcggcaccatc
gacacgttcctcatctggcggctcaccggcggcaagtccttcgtcaccgacgcgaccaac
gcgtcgcgcacgctgatctacaacatcgtcgacaatagctgggacgacgagctcaccgac
atcctgcgcatcccgcgggcgatgctgccggacgtgaaggattgcgccgccgacttcggc
gtcacggatgcgtccctcttcagcgcggcgatcccgatcctcggcgttgctggcgaccag
caggcggcaacgatcggccaggcctgcttcaagcccggcatgctgaaatccacctacggc
accggctgtttcgcgctgctcaacacggggaaggatatcgttcgttccaagaatcggctg
ctcaccaccatcgcctatcgcctcaatggcgagacgacttatgcgctcgaaggctcgatt
ttcgtggccggcgctgccgttcagtggttgcgcgacgggctcaaggtcatcaaggcggca
cccgacaccggtacgcttgccgaaagcgccgacccgacgcaggaggtttatctcgtgccg
gccttcaccggcctcggtgcgccgcactgggatccggatgcccgcggcgcgatctacggg
atgacgcgcaacaccggcccggccgaattcgcccgtgccgctctcgaatccgtctgctat
cagacgcgcgatctgctcgacgccatgcaccgggactggcgcagcaacggcaaggacacg
gtgttgcgtgtcgatggcggcatggtcgcctccgactggacgatgcaaaggctgtccgat
ctgctcgacgccccggtcgaccggccggtcatcctcgagacgacggcgctcggcgtcgcc
tggctcgccggcagccgcgccggagtctggcccacccaggaggagttcgccaagtcctgg
gcgcgcgaccggcgcttcgaaccgaagatggacgggacgacgcgcaagggcaagctcaag
ggctggcgcagcgcggtgaagcggacgctgatggcggcgtag

DBGET integrated database retrieval system