KEGG   Sinorhizobium fredii HH103: SFHH103_02412Help
Entry
SFHH103_02412     CDS       T01731                                 

Gene name
cyc
Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00920  Sulfur metabolism
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
sfh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SFHH103_02412 (cyc)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SFHH103_02412 (cyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CCE96907
UniProt: G9A9I6
Position
2582021..2582407
Genome map
AA seq 128 aa AA seqDB search
MRIAVVALSFSALLLCPVAGHAQEGDAEAGATVFKKCATCHVVDKDQNKVGPSLQGIIGR
TAGTHADFKYSQAMVDAGKGGLVWDDAALHEYLRNPKAKIKGTKMVFPGLKKDEEIVNVI
AYLKQHPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgctgttgttgccctgtctttttcggcactcctgctctgtccggttgccggc
catgcccaggagggcgatgccgaggccggagccacggtcttcaagaaatgcgccacctgc
cacgtcgtggacaaggaccagaacaaggtcggtccgtcgctgcagggcattatcggcagg
accgccggcacgcatgcggatttcaaatattcgcaagccatggtcgatgcgggcaagggc
gggctcgtctgggacgacgcggcattgcacgaatatctccgcaatcccaaagccaagatc
aaaggcaccaagatggtctttcccggcctcaagaaggacgaagagatcgtcaatgtgatt
gcctatctcaagcaacaccccaaatag

DBGET integrated database retrieval system