KEGG   Sinorhizobium fredii HH103: SFHH103_02412Help
Entry
SFHH103_02412     CDS       T01731                                 

Gene name
cyc
Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sfh00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sfh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2582021..2582407
Genome map
AA seq 128 aa AA seqDB search
MRIAVVALSFSALLLCPVAGHAQEGDAEAGATVFKKCATCHVVDKDQNKVGPSLQGIIGR
TAGTHADFKYSQAMVDAGKGGLVWDDAALHEYLRNPKAKIKGTKMVFPGLKKDEEIVNVI
AYLKQHPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgctgttgttgccctgtctttttcggcactcctgctctgtccggttgccggc
catgcccaggagggcgatgccgaggccggagccacggtcttcaagaaatgcgccacctgc
cacgtcgtggacaaggaccagaacaaggtcggtccgtcgctgcagggcattatcggcagg
accgccggcacgcatgcggatttcaaatattcgcaagccatggtcgatgcgggcaagggc
gggctcgtctgggacgacgcggcattgcacgaatatctccgcaatcccaaagccaagatc
aaaggcaccaagatggtctttcccggcctcaagaaggacgaagagatcgtcaatgtgatt
gcctatctcaagcaacaccccaaatag

DBGET integrated database retrieval system