KEGG   Sinorhizobium fredii HH103: SFHH103_02481Help
Entry
SFHH103_02481     CDS       T01731                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase,glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00625  Chloroalkane and chloroalkene degradation
sfh00680  Methane metabolism
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
sfh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SFHH103_02481 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SFHH103_02481 (fdhA)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SFHH103_02481 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD ADH_N_assoc FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CCE96976
UniProt: G9A9Q5
Position
complement(2656872..2658062)
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYMRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLVLGHEITGQVIEKGVDVEMLDIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPSRA
GGAYGYVDMGGWIGGQARYVTVPYADFNLLKFPDRDRAMEKIRDLTMLSDILPTGFHGAI
NAKVGVGSIVYVAGAGPVGLAAAASARILGAAVVMVGDFNKDRLAHAAKVGFEPIDLNAG
DNLGEMIAQVTGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGSLSLRLGLGWAKAQSFHTGQTPVLRYNRQLMQAILHDRLPIADIVN
AKVISLEDAVQGYESFDQGVAQKFVLDPHGELLKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacagaggtgtcgtctacatgcggcccggcaaggtcgaagtgcgagatatc
gacgatccgaagctcgaggcgccggacggccgccgcatcgaacatggcgtgatcctgaag
gtgatctccaccaatatctgcggctcggaccagcatatggtgcgcggccgaacgacggcc
atgcccgggctcgtgctcggccatgagatcaccggacaggtaatcgagaagggcgtcgat
gtcgagatgctcgacatcggcgacatcgtctccgttcccttcaacgtcgcctgcggccgg
tgccgctgctgcaagtcacaggacaccggcgtctgcctcacggtcaatccgtcacgcgcg
ggtggcgcctatggctatgtcgacatgggtggctggattggcggacaggcgcgctacgtg
acggtgccctatgccgatttcaacctcctgaagttccccgatcgggatcgcgcgatggag
aaaatccgtgacctgaccatgctttcggacatcctgccgacgggcttccacggcgcgatc
aacgcgaaggtcggggtgggctcgatcgtctatgtcgccggcgccggtcctgtcggcctg
gccgccgcggcttcggcccgcatcctcggcgcggctgtcgtcatggtcggcgatttcaac
aaggatcgcctcgcccatgccgccaaggtcggcttcgagccgatcgacctcaatgccggc
gacaatctgggcgaaatgattgcccaggtgacgggcagcaacgaggtcgatagcgccatc
gatgcggtcggcttcgaagcgcgcggccatagcggcggcgaacagccggcgatcgtgctg
aaccagatgatggaaatcacccgtgcggcgggctccatcggaattccgggcctctatgtg
acggaagatcccggcgcggtcgacaacgctgccaagcatggcagtctctcgcttcgcctc
ggtctgggctgggccaaggcgcagtccttccacacgggccagacgcccgtgctccgctac
aacagacagctgatgcaggccatcctgcacgatcgtctgccgatcgctgatatcgtcaat
gcgaaggtcatttcgctcgaggatgcggtgcaaggctacgagagcttcgaccagggcgtc
gcccagaagttcgtgctggatccgcatggtgagttgctgaaggccgcataa

DBGET integrated database retrieval system