KEGG   Sinorhizobium fredii HH103: SFHH103_02603Help
Entry
SFHH103_02603     CDS       T01731                                 

Gene name
acsa3
Definition
(GenBank) putative AMP-binding protein; AcsA-like
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00010  Glycolysis / Gluconeogenesis
sfh00620  Pyruvate metabolism
sfh00640  Propanoate metabolism
sfh00680  Methane metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_02603 (acsa3)
   00620 Pyruvate metabolism
    SFHH103_02603 (acsa3)
   00640 Propanoate metabolism
    SFHH103_02603 (acsa3)
  Energy metabolism
   00680 Methane metabolism
    SFHH103_02603 (acsa3)
Enzymes [BR:sfh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SFHH103_02603 (acsa3)
Lipid biosynthesis proteins [BR:sfh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SFHH103_02603 (acsa3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCE97098
UniProt: G9AAJ4
Position
complement(2802151..2803791)
Genome map
AA seq 546 aa AA seqDB search
MLPRIESYEELYREFRWRIPERFNIGVAVSDDWASRDPERVCLEHFSPGGAHRSLTYGAF
AARSSGFAGGLAAHGIKPGDRVAILLPQGFEVAIAHAAIYKLGAIALPLALLFGVEALAY
RLQDAEATAIVTNRFGYERLAAIRGELPDLRLVVLAEEEELPGTVQFDRLAAGEGRFVAA
DTGPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPEPGDRMWTPADWAWA
GGLLNALLPSLFFGVPVVSSPAQKFDPHMAFRIMEEMDVRNAFIPPTALRLLKSVDRPHA
RYRLNLRTIGSAGEALGRETFEWAKEALGIAVSEFYGQTECNIVISSAADLGVLKPGSMG
KAAPGHAVAIIDGEGRVLPPGTTGQVAVRRPDPVMFLGYWRNDKATEAKFIGDWMTTGDQ
GVMDAEGYFTFFGRDDDVITSSGYRIGPGEIEDCLAGHPDVQMAAAIGKPDPIRTEIIKA
YVVLKPGAVASDETAAAIRSWVKNRLSMHEYPREIEFVDSLPLTTSGKVIRRLLRERAAA
EVAAGT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgagaatcgagagctacgaggaactctatcgtgaattccgctggcggattccg
gagcggttcaatatcggcgtcgccgtcagcgacgattgggcgtcgcgcgatccggagcgt
gtctgccttgagcatttcagtcccggcggcgcgcatcgctcgctgacatatggtgccttc
gcggcccgctcctccggctttgccggagggcttgccgcgcatggcatcaagccgggcgat
cgcgtcgccatcctgctaccgcagggtttcgaagtggcgatcgcccatgcggcgatctac
aagctcggggcgatcgccctgccgctggcgctgctcttcggcgtagaggcgctcgcctat
cggctgcaggacgcagaagcaactgcgatcgtcaccaatcgcttcggctacgagcggctt
gcggcgatccggggcgagctgccggacctccggctggttgtgctggcggaagaggaggaa
ctccccgggacggtgcagttcgaccgtctggcggcgggcgagggccgcttcgtcgctgcc
gacaccgggccggacgatccggcgctgatgatctacacgtcggggacgaccgggccgccg
aagggcgccttgcatggccatcgcgtgctgcttggccatctgccgggcttccagttccac
catcatttcctgcccgaaccgggcgaccggatgtggacgccggccgactgggcctgggca
ggcggcttgctcaacgcgttgctgccctcgctgttcttcggcgtgccggtggtctcctcg
ccggcgcagaagttcgatccgcacatggccttccgcatcatggaagagatggacgtgcgc
aacgccttcattccgccgaccgcactcaggctgctgaaatccgtcgatcgaccgcacgcc
cgctacaggctcaatctgaggacgatcggctcggcgggggaagcgctcgggcgcgaaacc
ttcgaatgggcgaaagaggcgctcggcatcgcggtcagcgaattctacggccagacggaa
tgcaacatcgtgatttcctcggcggccgatctcggcgtgctgaagcccggctcgatgggc
aaggccgcacccggccacgcggtggcgatcatcgacggcgaggggcgggtgctgccgccg
ggcacgaccgggcaggtcgccgtcaggcgccccgatccggtgatgtttctcggctactgg
cgaaacgacaaggcgaccgaggcgaagttcatcggcgactggatgaccaccggtgaccag
ggcgtcatggatgccgagggctatttcaccttcttcggccgggacgatgatgtcatcacc
tcgtcgggctacaggatcggtcccggcgagatcgaggattgcctggcggggcatccggac
gtccagatggccgccgccatcggcaagccggatccgatccgcaccgagatcatcaaggcc
tatgtggtgctgaagcccggggcagttgcgagcgacgagaccgcggccgcgatccgcagc
tgggtgaagaacaggctctccatgcacgaatatccgcgcgagatcgagttcgtcgacagc
ctgccgctgaccacctcgggcaaggtgatccggcgcttgctgcgggaaagggcggcggcg
gaggtcgctgcaggcacttaa

DBGET integrated database retrieval system