KEGG   Sinorhizobium fredii HH103: SFHH103_02875Help
Entry
SFHH103_02875     CDS       T01731                                 

Gene name
exoN
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SFHH103_02875 (exoN)
   00052 Galactose metabolism
    SFHH103_02875 (exoN)
   00500 Starch and sucrose metabolism
    SFHH103_02875 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    SFHH103_02875 (exoN)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SFHH103_02875 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3100549..3101436)
Genome map
AA seq 295 aa AA seqDB search
MTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAILPKAGTTSFTRQQAPLGLGHAVWC
ARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEHSGGNVIAVEECAPEQAHKYGIVGVG
DRVGDGFKITKMVEKPARGTAPSNFFINGRYILQPEIFPILERQERGAGNEIQLTDGMVK
LAEAQAFAAYHFRGETYDCGAKDGFILANVAFALERADIRPTVEGPLKTLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcgtaaagtccgcaaagccgtcttccccgtcgccgggctggggacacgt
tttcttcccgccaccaaggcggtgccgaaggaaatgctgacggtcgtggacaagccggtc
atccagtatgtcgtcgacgaggcgctggaagcggggatcgagcatctgatcttcgtcacc
ggtcgcagcaaggcggtcatcgaggattatttcgacattcaggtcgagctcgaccagacg
ctcagagaacgcaacaagaaagcggaaatcgagctgctcgaagcgatactgccgaaggcc
ggcacgacgagtttcacccgccagcaggcaccgctcggcctcggccacgcggtctggtgc
gcgcgcgatctcgtcggcaacgagcccttcgcactgctgctccccgacatgatcatgaag
ggcgagaagggctgcctcaagggcatggtcgagctctacgaacacagcggcggcaatgtc
atcgccgtcgaggaatgcgcccccgagcaggcgcacaaatacggcatcgtcggcgtcggc
gacagggtcggcgacggcttcaagatcaccaagatggtcgagaagccggcccggggcacg
gcgccgtccaatttcttcatcaacggccgctatatcctgcagccggaaatcttcccgatt
ctggagcgccaggagcgcggcgccggcaacgagatccagttgaccgacgggatggtgaag
cttgccgaggcacaggctttcgccgcctatcatttccgcggcgagacctatgattgcggg
gcgaaggacggcttcatcctcgccaacgtcgccttcgccctcgagcgcgccgatatccgc
ccgaccgtcgaggggccgctcaagacgctgctgcaaggattgaagtag

DBGET integrated database retrieval system